Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human VEGFA (Iv0071)

  • ARO-A13303-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €358.00.Current price is: €256.00.

50ug 28% OFF + 256 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SEC-HPLC of InVivoMAb Anti-Human VEGFA (Iv0071)
SDS-PAGE for InVivoMAb Anti-Human VEGFA (Iv0071)
Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)
Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)
Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)

InVivoMAb Anti-Human VEGFA (Iv0071)

Product name ARO-A13303-100
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-VEGF, Vascular endothelial growth factor A, VPF, VEGFA, Vascular permeability factor, VEGF-A
Reference ARO-A13303
Clonality Monoclonal Antibody
Protein Name VEGF
Product name ARO-A13303-1MG
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-VEGF, Vascular endothelial growth factor A, VPF, VEGFA, Vascular permeability factor, VEGF-A
Reference ARO-A13303
Clonality Monoclonal Antibody
Protein Name VEGF
Product name ARO-A13303-50
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-VEGF, Vascular endothelial growth factor A, VPF, VEGFA, Vascular permeability factor, VEGF-A
Reference ARO-A13303
Clonality Monoclonal Antibody
Protein Name VEGF

SEC-HPLC of InVivoMAb Anti-Human VEGFA (Iv0071)

SEC-HPLC of InVivoMAb Anti-Human VEGFA (Iv0071)

InVivoMAb Anti-Human VEGFA (Iv0071)was analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for InVivoMAb Anti-Human VEGFA (Iv0071)

SDS-PAGE for InVivoMAb Anti-Human VEGFA (Iv0071)

InVivoMAb Anti-Human VEGFA (Iv0071), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)

Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)

Flow-cytometry using anti-human VEGFA antibody.VEGFA Transfected CHO cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human VEGFA antibody monoclonal antibody (Catalog # ARO-A13303 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)

Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)

Flow-cytometry using APC anti-human VEGFA antibody. U87 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an APC anti-human VEGFA monoclonal antibody (Catalog: ARO-A13303, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)

Flow Cytometry results for InVivoMAb Anti-Human VEGFA (Iv0071)

Flow-cytometry using FITC anti-human VEGFA antibody. U87 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human VEGFA monoclonal antibody (Catalog: ARO-A13303, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human VEGFA (Iv0071)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products