Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Toxoplasma gondii TgRA15 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Toxoplasma gondii
Uniprot ID:
S8EY82
Molecular weight:
29.39 kDa

€210.00

50ug + 210 loyalty points
Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Toxoplasma gondii TgRA15 Recombinant Protein

Toxoplasma gondii TgRA15 Recombinant Protein

Product name Toxoplasma gondii TgRA15 Recombinant Protein
Uniprot ID S8EY82
Uniprot link http://www.uniprot.org/uniprot/S8EY82
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHLEVLFQGPRSVREQYNASEVDPGENSATGGGVGDPFLGNKRENNTSFKVLESRSVCTPEELRRRSTLLTTILRTLSRSSLRRHPLNSPFERAWRQLKIIDLYLQFNVGPLRVDDEEALQFLSLARTKKLLNLVHVSQVQK
Molecular weight 29.39 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:SwissProtID S8EY82
NCBI Reference XP_002365661.1
Aliases /Synonyms TgRA15, RAP domain-containing protein
Reference PX-P2097
Note For research use only
Molecular Constructor
Yes
Product name Toxoplasma gondii TgRA15 Recombinant Protein
Uniprot ID S8EY82
Uniprot link http://www.uniprot.org/uniprot/S8EY82
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHLEVLFQGPRSVREQYNASEVDPGENSATGGGVGDPFLGNKRENNTSFKVLESRSVCTPEELRRRSTLLTTILRTLSRSSLRRHPLNSPFERAWRQLKIIDLYLQFNVGPLRVDDEEALQFLSLARTKKLLNLVHVSQVQK
Molecular weight 29.39 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:SwissProtID S8EY82
NCBI Reference XP_002365661.1
Aliases /Synonyms TgRA15, RAP domain-containing protein
Reference PX-P2097
Note For research use only
Molecular Constructor
Yes

There are no reviews yet.

Be the first to review “Toxoplasma gondii TgRA15 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products