Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Toxoplasma gondii
Uniprot ID:
P13403
Molecular weight:
22,92 kDa

€210.00

50ug + 210 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

Product name Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein
Uniprot ID P13403
Uniprot link http://www.uniprot.org/uniprot/P13403
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Raw Antigen Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTY RVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLE DAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERELEHHHHHH
Molecular weight 22,92 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession P13403.1
Spec:SwissProtID P13403
NCBI Reference P13403.1
Aliases /Synonyms GRA1(25-190)(RH) (=14), Dense granule protein 1 , Protein GRA 1, Major antigen p24, Dense granule protein 1
Reference PX-P1093
Note For research use only
Molecular Constructor
Partial Yes
Product name Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein
Uniprot ID P13403
Uniprot link http://www.uniprot.org/uniprot/P13403
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Raw Antigen Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTY RVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLE DAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERELEHHHHHH
Molecular weight 22,92 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession P13403.1
Spec:SwissProtID P13403
NCBI Reference P13403.1
Aliases /Synonyms GRA1(25-190)(RH) (=14), Dense granule protein 1 , Protein GRA 1, Major antigen p24, Dense granule protein 1
Reference PX-P1093
Note For research use only
Molecular Constructor
Partial Yes

General information on Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein:

Dense granules are specific secretory organelles. Dense granule protein 1 (GRA1) of Toxoplasma gondii is located in the dense granules of two forms: tachyzoite and bradyzoite. It has an immunoprophylactic interest in toxoplasmosis.

Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

  • Cesbron-Delauw MF, Guy B, Torpier G, Pierce RJ, Lenzen G, Cesbron JY, Charif H, Lepage P, Darcy F, Lecocq JP, et al. Molecular characterization of a 23-kilodalton major antigen secreted by Toxoplasma gondii. Proc Natl Acad Sci U S A. 1989 Oct;86(19):7537-41. PubMed PMID: 2798425; PubMed Central PMCID: PMC298100.

There are no reviews yet.

Be the first to review “Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products