Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Toxoplasma gondii
Uniprot ID:
Q1RS40
Molecular weight:
10,80 kDa

€210.00

50ug + 210 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein

Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein

Product name Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein
Uniprot ID Q1RS40
Uniprot link http://www.uniprot.org/uniprot/Q1RS40
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTTGRRSPQEPSGGGGGNDAGNNAGNGGNEGRGEGGEDDRRPLH PGSVNEFDFKLAAALEHHHHHH
Molecular weight 10,80 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM if native conditions. PBS, imidazole 400mM, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAG25735.1
Spec:SwissProtID Q1RS40
NCBI Reference CAG25735.1
Aliases /Synonyms GRA6Ct(174-224)(76K), dense granule antigen
Reference PX-P1098
Note For research use only
Molecular Constructor
Partial Yes
Product name Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein
Uniprot ID Q1RS40
Uniprot link http://www.uniprot.org/uniprot/Q1RS40
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTTGRRSPQEPSGGGGGNDAGNNAGNGGNEGRGEGGEDDRRPLH PGSVNEFDFKLAAALEHHHHHH
Molecular weight 10,80 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM if native conditions. PBS, imidazole 400mM, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAG25735.1
Spec:SwissProtID Q1RS40
NCBI Reference CAG25735.1
Aliases /Synonyms GRA6Ct(174-224)(76K), dense granule antigen
Reference PX-P1098
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products