Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Toxoplasma gondii GRA2(21-185)(76K) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Toxoplasma gondii
Uniprot ID:
B6KEX2
Molecular weight:
22,84 kDa

210.00

50ug + 210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Toxoplasma gondii GRA2(21-185)(76K) Recombinant Protein

Product name Toxoplasma gondii GRA2(21-185)(76K) Recombinant Protein
Uniprot ID B6KEX2
Uniprot link http://www.uniprot.org/uniprot/B6KEX2
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Raw Antigen Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLMRAAEFSGVVNQGPVDVPFSGKPLDERAVGGKGEHTPPLPDERQ QEPEEPVSQRASRVAEQLFRKFLKFAENVGQHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKEAAGRGMVTVGKKLANV ESDRSTTTTQAPDSPNGLAETQAPVEPQQRAAHVPVPDFSQLEHHHHHH
Molecular weight 22,84 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_002366395.1
Spec:Entrez GeneID 7897424
Spec:SwissProtID S8EXV7
NCBI Reference XP_002366395.1
Aliases /Synonyms GRA2(21-185)(76K), 28kd antigen
Reference PX-P1094
Note For research use only
Molecular Constructor
Partial Yes
Product name Toxoplasma gondii GRA2(21-185)(76K) Recombinant Protein
Uniprot ID B6KEX2
Uniprot link http://www.uniprot.org/uniprot/B6KEX2
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Raw Antigen Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLMRAAEFSGVVNQGPVDVPFSGKPLDERAVGGKGEHTPPLPDERQ QEPEEPVSQRASRVAEQLFRKFLKFAENVGQHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKEAAGRGMVTVGKKLANV ESDRSTTTTQAPDSPNGLAETQAPVEPQQRAAHVPVPDFSQLEHHHHHH
Molecular weight 22,84 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_002366395.1
Spec:Entrez GeneID 7897424
Spec:SwissProtID S8EXV7
NCBI Reference XP_002366395.1
Aliases /Synonyms GRA2(21-185)(76K), 28kd antigen
Reference PX-P1094
Note For research use only
Molecular Constructor
Partial Yes

Toxoplasma gondii GRA2(21-185)(76K) Recombinant Protein

There are no reviews yet.

Be the first to review “Toxoplasma gondii GRA2(21-185)(76K) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products