Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameToxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein
Uniprot IDQ25C72
Uniprot linkhttp://www.uniprot.org/uniprot/Q25C72
Origin speciesToxoplasma gondii
Expression systemProcaryotic expression
SequenceMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTAVAADSGGVRQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQ GDSLAEDDTTSDAAEGDVDPFPALANEGKSEARGPSLEERIEEQGTRRRYSSVEEPQAKVPSKRTQKRHRKLAAALEHHH HHH
Molecular weight17,41 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, imidazole 300mM if native conditions. PBS, imidazole 400mM, Urea 8M if denaturing conditions
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionXP_002371939
Spec:Entrez GeneID7895853
Spec:SwissProtIDS8EZ84
NCBI ReferenceXP_002371939
Aliases /SynonymsGRA6Nt(41-152)(76K), granule antigen protein GRA6
ReferencePX-P1101
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.







    X