Name: Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein
SKU: PX-P1101-10
Availability: InStock

Product name	Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein
Uniprot ID	Q25C72
Uniprot link	http://www.uniprot.org/uniprot/Q25C72
Origin species	Toxoplasma gondii
Expression system	Prokaryotic expression
Sequence	MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTAVAADSGGVRQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQ GDSLAEDDTTSDAAEGDVDPFPALANEGKSEARGPSLEERIEEQGTRRRYSSVEEPQAKVPSKRTQKRHRKLAAALEHHH HHH
Molecular weight	17,41 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, imidazole 300mM if native conditions. PBS, imidazole 400mM, Urea 8M if denaturing conditions
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Protein Accession	XP_002371939
Spec:Entrez GeneID	7895853
Spec:SwissProtID	S8EZ84
NCBI Reference	XP_002371939
Aliases /Synonyms	GRA6Nt(41-152)(76K), granule antigen protein GRA6
Reference	PX-P1101
Note	For research use only

No Products found