Toxoplasma gondii GRA2(21-185)(RH) Recombinant Protein

Reference:
Product nameToxoplasma gondii GRA2(21-185)(RH) Recombinant Protein
Uniprot IDP13404
Uniprot linkhttp://www.uniprot.org/uniprot/P13404
Origin speciesToxoplasma gondii
Expression systemProcaryotic expression
SequenceMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKSPGFSSTMDMRAAEFSGVVNQGPVDVPFSGKPLDERA VGGKGEHTPPLPDERQQEPEEPVSQRASRVAEQLFRKFLKFAENVGHHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKE AAGRGMVTVGKKLANVESDRSTTTTQAPDSPNGLAETEVPVEPQQRAAHVPVPDFSQADPNSSSVDKLAAALEHHHHHH
Molecular weight25,86 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, imidazole 300mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAA30138.1
Spec:SwissProtIDP13404
NCBI ReferenceAAA30138.1
Aliases /SynonymsGRA2(21-185)(RH), 28kd antigen
ReferencePX-P1095
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Toxoplasma gondii GRA2(21-185)(RH) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.