Stimulator of interferon genes protein(TMEM173)

Reference:
Product nameStimulator of interferon genes protein(TMEM173)
Uniprot IDQ86WV6
Uniprot linkhttps://www.uniprot.org/uniprot/Q86WV6
Expression systemProcaryotic expression
SequenceMGSHHHHHHSGGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDC GVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLE QAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLIS GMEKPLPLRTDFS
Molecular weight28.4kDa
Protein delivered with Tag?N-terminal His Tag
Purity estimated>85% by SDS-PAGE
BufferPBS, pH7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeGly138-Ser379
Protein AccessionQ86WV6
Spec:Entrez GeneID340061
Spec:NCBI Gene AliasesERIS; MITA; MPYS; SAVI; NET23; STING; hMITA; hSTING; TMEM173; STING-beta
Spec:SwissProtIDB6EB35
NCBI ReferenceQ86WV6
Aliases /SynonymsEndoplasmic reticulum interferon stimulator,ERIS,Mediator of IRF3 activation,hMITA,Transmembrane protein 173,ERIS,MITA,STING
ReferencePX-P4843
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Stimulator of interferon genes protein(TMEM173)”

Your email address will not be published. Required fields are marked *

Related products

Barecetamab Biosimilar – Anti-ERBB3 mAb – Research Grade
Biosimilar Barecetamab Biosimilar – Anti-ERBB3 mAb – Research Grade PX-TA1646 400€
Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.