Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mucin-4(MUC4) EGF Like 1 and 2

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q99102
Molecular weight:
30.26KDa

€394.00

100ug + 394 loyalty points
Gln1875–Glu2117 His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mucin-4(MUC4) EGF Like 1 and 2

Mucin-4(MUC4) EGF Like 1 and 2

Product name Mucin-4(MUC4) EGF Like 1 and 2
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAMAQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISEEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEGSHHHHHH
Molecular weight 30.26KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 70% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM GSH, 0.5 mM GSSG
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Glu2117
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4, ASGP-1
Reference PX-P4396
Note For research use only
Molecular Constructor
Gln1875–Glu2117 His
Product name Mucin-4(MUC4) EGF Like 1 and 2
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAMAQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISEEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEGSHHHHHH
Molecular weight 30.26KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 70% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM GSH, 0.5 mM GSSG
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Glu2117
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4, ASGP-1
Reference PX-P4396
Note For research use only
Molecular Constructor
Gln1875–Glu2117 His

There are no reviews yet.

Be the first to review “Mucin-4(MUC4) EGF Like 1 and 2”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products