Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mucin-4(MUC4) EGF Like 1 and 2

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q99102
Molecular weight:
30.26KDa

Original price was: €248.00.Current price is: €210.00.

50ug 15% OFF + 210 loyalty points
Gln1875–Glu2117 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mucin-4(MUC4) EGF Like 1 and 2

Product name Mucin-4(MUC4) EGF Like 1 and 2
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMAQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISEEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEGSHHHHHH
Molecular weight 30.26KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 70% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM GSH, 0.5 mM GSSG
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Glu2117
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4, ASGP-1
Reference PX-P4396
Note For research use only
Molecular Constructor
Gln1875–Glu2117 His
Product name Mucin-4(MUC4) EGF Like 1 and 2
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMAQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISEEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEGSHHHHHH
Molecular weight 30.26KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 70% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM GSH, 0.5 mM GSSG
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Glu2117
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4, ASGP-1
Reference PX-P4396
Note For research use only
Molecular Constructor
Gln1875–Glu2117 His
Product name PX-P4396-1MG
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMAQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISEEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEGSHHHHHH
Molecular weight 30.26KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 70% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM GSH, 0.5 mM GSSG
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Glu2117
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4, ASGP-1
Reference PX-P4396
Note For research use only
Molecular Constructor
Gln1875–Glu2117 His

Mucin-4(MUC4) EGF Like 1 and 2

There are no reviews yet.

Be the first to review “Mucin-4(MUC4) EGF Like 1 and 2”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products