Brand: ProteoGenix

RNA-binding protein 38(RBM38)

PX-P4832-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Uniprot ID:: Q9H0Z9
Molecular weight:: 38.3kDa

Original price was: €273.00.Current price is: €210.00.

50ug 23% OFF + 210 loyalty points

GST Thr132–Gln239

Size Size

50ug Original price was: €273.00.Current price is: €210.00.
100ug Original price was: €398.00.Current price is: €329.00.
1MG Original price was: €1,068.00.Current price is: €954.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

RNA-binding protein 38(RBM38)

Product name	RNA-binding protein 38(RBM38)
Uniprot ID	Q9H0Z9
Uniprot link	https://www.uniprot.org/uniprot/Q9H0Z9
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight	38.3kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>75% by SDS-PAGE
Buffer	PBS, pH 7.5, 4M urea
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Thr132-Gln239
Protein Accession	Q9H0Z9
Spec:Entrez GeneID	55544
Spec:NCBI Gene Aliases	RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference	Q9H0Z9
Aliases /Synonyms	CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference	PX-P4832
Note	For research use only
Molecular Constructor	GST Thr132–Gln239

Product name	RNA-binding protein 38(RBM38)
Uniprot ID	Q9H0Z9
Uniprot link	https://www.uniprot.org/uniprot/Q9H0Z9
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight	38.3kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>75% by SDS-PAGE
Buffer	PBS, pH 7.5, 4M urea
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Thr132-Gln239
Protein Accession	Q9H0Z9
Spec:Entrez GeneID	55544
Spec:NCBI Gene Aliases	RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference	Q9H0Z9
Aliases /Synonyms	CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference	PX-P4832
Note	For research use only
Molecular Constructor	GST Thr132–Gln239

Product name	PX-P4832-1MG
Uniprot ID	Q9H0Z9
Uniprot link	https://www.uniprot.org/uniprot/Q9H0Z9
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight	38.3kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>75% by SDS-PAGE
Buffer	PBS, pH 7.5, 4M urea
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Thr132-Gln239
Protein Accession	Q9H0Z9
Spec:Entrez GeneID	55544
Spec:NCBI Gene Aliases	RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference	Q9H0Z9
Aliases /Synonyms	CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference	PX-P4832
Note	For research use only
Molecular Constructor	GST Thr132–Gln239