Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

RNA-binding protein 38(RBM38)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9H0Z9
Molecular weight:
38.3kDa

Original price was: €273.00.Current price is: €210.00.

50ug 23% OFF + 210 loyalty points
GST Thr132–Gln239
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

RNA-binding protein 38(RBM38)

Product name RNA-binding protein 38(RBM38)
Uniprot ID Q9H0Z9
Uniprot link https://www.uniprot.org/uniprot/Q9H0Z9
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight 38.3kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH 7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr132-Gln239
Protein Accession Q9H0Z9
Spec:Entrez GeneID 55544
Spec:NCBI Gene Aliases RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference Q9H0Z9
Aliases /Synonyms CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference PX-P4832
Note For research use only
Molecular Constructor
GST Thr132–Gln239
Product name RNA-binding protein 38(RBM38)
Uniprot ID Q9H0Z9
Uniprot link https://www.uniprot.org/uniprot/Q9H0Z9
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight 38.3kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH 7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr132-Gln239
Protein Accession Q9H0Z9
Spec:Entrez GeneID 55544
Spec:NCBI Gene Aliases RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference Q9H0Z9
Aliases /Synonyms CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference PX-P4832
Note For research use only
Molecular Constructor
GST Thr132–Gln239
Product name PX-P4832-1MG
Uniprot ID Q9H0Z9
Uniprot link https://www.uniprot.org/uniprot/Q9H0Z9
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight 38.3kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH 7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr132-Gln239
Protein Accession Q9H0Z9
Spec:Entrez GeneID 55544
Spec:NCBI Gene Aliases RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference Q9H0Z9
Aliases /Synonyms CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference PX-P4832
Note For research use only
Molecular Constructor
GST Thr132–Gln239

RNA-binding protein 38(RBM38)

There are no reviews yet.

Be the first to review “RNA-binding protein 38(RBM38)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products