Name: RNA-binding protein 38(RBM38)
SKU: PX-P4832-10
Availability: InStock

Product name	RNA-binding protein 38(RBM38)
Uniprot ID	Q9H0Z9
Uniprot link	https://www.uniprot.org/uniprot/Q9H0Z9
Expression system	Prokaryotic expression
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight	38.3kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>75% by SDS-PAGE
Buffer	PBS, pH 7.5, 4M urea
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Thr132-Gln239
Protein Accession	Q9H0Z9
Spec:Entrez GeneID	55544
Spec:NCBI Gene Aliases	RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference	Q9H0Z9
Aliases /Synonyms	CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference	PX-P4832
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “RNA-binding protein 38(RBM38)”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17859 180€

View product