Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mucin-4(MUC4) Nter GST

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q99102
Molecular weight:
30.75kDa

Original price was: €252.00.Current price is: €210.00.

50ug 17% OFF + 210 loyalty points
Gst Gln1875–Phe1914
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mucin-4(MUC4) Nter GST

Product name Mucin-4(MUC4) Nter GST
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCF
Molecular weight 30.75kDa
Protein delivered with Tag? N-terminal Gst Tag
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl ,pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Phe1914
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4
Reference PX-P4406
Note For research use only
Molecular Constructor
Gst Gln1875–Phe1914
Product name Mucin-4(MUC4) Nter GST
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCF
Molecular weight 30.75kDa
Protein delivered with Tag? N-terminal Gst Tag
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl ,pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Phe1914
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4
Reference PX-P4406
Note For research use only
Molecular Constructor
Gst Gln1875–Phe1914
Product name PX-P4406-1MG
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCF
Molecular weight 30.75kDa
Protein delivered with Tag? N-terminal Gst Tag
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl ,pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Phe1914
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4
Reference PX-P4406
Note For research use only
Molecular Constructor
Gst Gln1875–Phe1914

Mucin-4(MUC4) Nter GST

There are no reviews yet.

Be the first to review “Mucin-4(MUC4) Nter GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products