Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

G1-S specific cyclin-D2(CCND2)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P30279
Molecular weight:
33.07 kDa

Original price was: €215.00.Current price is: €182.00.

50ug 15% OFF + 182 loyalty points
His Met1–Leu289
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

G1-S specific cyclin-D2(CCND2)

Product name G1-S specific cyclin-D2(CCND2)
Uniprot ID P30279
Uniprot link https://www.uniprot.org/uniprot/P30279
Expression system Prokaryotic expression
Raw Antigen Sequence MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Molecular weight 33.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu289
Protein Accession P30279
Spec:Entrez GeneID 894
Spec:NCBI Gene Aliases MPPH3; KIAK0002
Spec:SwissProtID Q13955
NCBI Reference P30279
Reference PX-P4713
Note For research use only
Molecular Constructor
His Met1–Leu289
Product name G1-S specific cyclin-D2(CCND2)
Uniprot ID P30279
Uniprot link https://www.uniprot.org/uniprot/P30279
Expression system Prokaryotic expression
Raw Antigen Sequence MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Molecular weight 33.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu289
Protein Accession P30279
Spec:Entrez GeneID 894
Spec:NCBI Gene Aliases MPPH3; KIAK0002
Spec:SwissProtID Q13955
NCBI Reference P30279
Reference PX-P4713
Note For research use only
Molecular Constructor
His Met1–Leu289
Product name PX-P4713-1MG
Uniprot ID P30279
Uniprot link https://www.uniprot.org/uniprot/P30279
Expression system Prokaryotic expression
Raw Antigen Sequence MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Molecular weight 33.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu289
Protein Accession P30279
Spec:Entrez GeneID 894
Spec:NCBI Gene Aliases MPPH3; KIAK0002
Spec:SwissProtID Q13955
NCBI Reference P30279
Reference PX-P4713
Note For research use only
Molecular Constructor
His Met1–Leu289

G1-S specific cyclin-D2(CCND2)

There are no reviews yet.

Be the first to review “G1-S specific cyclin-D2(CCND2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products