Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Solrikitug Biosimilar – Anti-TSLP mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Solrikitug Biosimilar - Anti-TSLP mAb - Research Grade

Product name PX-TA2142-50
Uniprot ID Q969D9
Source CAS: 2768721-24-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2142
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Solrikitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2768721-24-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2142
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Solrikitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2768721-24-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2142
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Solrikitug Biosimilar – Anti-TSLP mAb

Solrikitug Biosimilar – Anti-TSLP mAb is a novel therapeutic antibody that targets the cytokine thymic stromal lymphopoietin (TSLP). This biosimilar is a research grade version of the original Solrikitug antibody, which has shown promising results in clinical trials for the treatment of various inflammatory diseases. In this article, we will explore the structure, activity, and potential applications of Solrikitug Biosimilar – Anti-TSLP mAb.

Structure of Solrikitug Biosimilar – Anti-TSLP mAb

Solrikitug Biosimilar – Anti-TSLP mAb is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region is responsible for binding to TSLP, while the constant region determines the antibody’s effector functions.

The structure of Solrikitug Biosimilar – Anti-TSLP mAb is similar to that of the original Solrikitug antibody, with minor differences in the amino acid sequence. These differences do not affect the antibody’s binding affinity or specificity for TSLP.

Activity of Solrikitug Biosimilar – Anti-TSLP mAb

TSLP is a cytokine that plays a crucial role in regulating immune responses and promoting inflammation. Overproduction of TSLP has been linked to various inflammatory diseases, including asthma, atopic dermatitis, and inflammatory bowel disease.

Solrikitug Biosimilar – Anti-TSLP mAb works by binding to TSLP and blocking its interaction with its receptor on immune cells. This prevents the activation of immune cells and the release of pro-inflammatory cytokines, leading to a reduction in inflammation.

In addition, Solrikitug Biosimilar – Anti-TSLP mAb has been shown to promote the production of regulatory T cells, which help to suppress excessive immune responses. This dual mechanism of action makes it a promising therapeutic agent for the treatment of inflammatory diseases.

Title: Applications of Solrikitug Biosimilar – Anti-TSLP mAb

Solrikitug Biosimilar – Anti-TSLP mAb has shown potential for the treatment of various inflammatory diseases, particularly those involving TSLP overproduction. Clinical trials have demonstrated its efficacy in reducing symptoms and improving lung function in patients with asthma and atopic dermatitis.

In addition, Solrikitug Biosimilar – Anti-TSLP mAb has also shown promise in the treatment of inflammatory bowel disease. Studies have shown that it can reduce inflammation and promote mucosal healing in patients with Crohn’s disease and ulcerative colitis.

Furthermore, Solrikitug Biosimilar – Anti-TSLP mAb may also have potential in the treatment of other immune-mediated disorders, such as rheumatoid arthritis and multiple sclerosis, where TSLP has been implicated in disease pathogenesis.

Conclusion

In conclusion, Solrikitug Biosimilar – Anti-TSLP mAb is a research grade therapeutic antibody that targets the cytokine TSLP. Its structure is similar to that of the original Solrikitug antibody, with minor differences in the amino acid sequence. It works by blocking the interaction between TSLP and its receptor, leading to a reduction in inflammation and promotion of regulatory T cell production. Clinical trials have shown its potential for the treatment of various inflammatory diseases, making it a promising therapeutic option for patients.

SDS-PAGE for Research Grade Solrikitug

SDS-PAGE for Research Grade Solrikitug

Research Grade Solrikitug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Solrikitug Biosimilar - Anti-TSLP mAb - Research Grade

There are no reviews yet.

Be the first to review “Solrikitug Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products