Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Amlenetug Biosimilar – Anti-Alpha-synuclein mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Amlenetug Biosimilar - Anti-Alpha-synuclein mAb - Research Grade

Product name PX-TA2166-50
Uniprot ID P37840
Source CAS: 2850367-41-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2166-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Amlenetug Biosimilar - Anti-Alpha-synuclein mAb - Research Grade
Uniprot ID P37840
Source CAS: 2850367-41-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2166-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Amlenetug Biosimilar - Anti-Alpha-synuclein mAb - Research Grade
Uniprot ID P37840
Source CAS: 2850367-41-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2166-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Amlenetug Biosimilar is a therapeutic antibody that targets the protein alpha-synuclein. This biosimilar is a research grade version of the original therapeutic antibody, and is used in scientific research to study the structure, activity, and potential applications of anti-alpha-synuclein antibodies. In this article, we will delve into the details of Amlenetug Biosimilar, discussing its structure, activity, and potential applications as a therapeutic antibody.

Structure of Amlenetug Biosimilar

Amlenetug Biosimilar is a monoclonal antibody, meaning it is produced from a single clone of immune cells. It is designed to specifically bind to alpha-synuclein, a protein that is found in high levels in the brain and is associated with neurodegenerative diseases such as Parkinson’s and Alzheimer’s. The antibody is made up of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains contain a constant region and a variable region, while the light chains contain only a constant region. The variable regions are responsible for binding to the target protein, while the constant regions determine the antibody’s effector functions.

Activity of Amlenetug Biosimilar

The primary function of Amlenetug Biosimilar is to bind to alpha-synuclein, preventing its aggregation and promoting its clearance from the brain. Alpha-synuclein is known to form clumps or aggregates in the brains of individuals with neurodegenerative diseases, and these aggregates are thought to contribute to the progression of these diseases. By binding to alpha-synuclein, Amlenetug Biosimilar helps to prevent the formation of these aggregates and potentially slow down the progression of neurodegenerative diseases.

In addition to its binding activity, Amlenetug Biosimilar also has effector functions that can further aid in the clearance of alpha-synuclein. These include activating immune cells to engulf and destroy the bound protein, as well as activating the complement system to promote its clearance.

Potential Applications of Amlenetug Biosimilar

The primary application of Amlenetug Biosimilar is in scientific research, particularly in the study of alpha-synuclein and its role in neurodegenerative diseases. By using this biosimilar, researchers can better understand the structure and function of alpha-synuclein and its potential as a therapeutic target. This could lead to the development of new and improved treatments for neurodegenerative diseases.

Furthermore, Amlenetug Biosimilar may also have potential as a therapeutic antibody in the treatment of neurodegenerative diseases. Clinical trials are currently underway to evaluate the safety and efficacy of this biosimilar in patients with Parkinson’s disease. If successful, Amlenetug Biosimilar could become a valuable treatment option for individuals with neurodegenerative diseases.

Conclusion

In summary, Amlenetug Biosimilar is a research grade therapeutic antibody that specifically targets alpha-synuclein. Its structure consists of two heavy chains and two light chains, and its primary activity is to bind to and potentially clear alpha-synuclein. This biosimilar has potential applications in scientific research and as a therapeutic antibody for neurodegenerative diseases. As research continues, Amlenetug Biosimilar may prove to be a valuable tool in the fight against these debilitating diseases.

SDS-PAGE for Amlenetug Biosimilar - Research Grade

SDS-PAGE for Amlenetug Biosimilar - Research Grade

Amlenetug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Amlenetug Biosimilar – Anti-Alpha-synuclein mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products