Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Indenebart Biosimilar – Anti-Alpha-synuclein mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda2

Original price was: €182.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Indenebart Biosimilar - Anti-Alpha-synuclein mAb - Research Grade

Product name PX-TA2167-50
Uniprot ID P37840
Source CAS: 2864437-88-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2167-100
Note For research use only. Not suitable for human use.
Isotype IgG1, lambda2
Clonality Monoclonal Antibody
Product name Indenebart Biosimilar - Anti-Alpha-synuclein mAb - Research Grade
Uniprot ID P37840
Source CAS: 2864437-88-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2167-100
Note For research use only. Not suitable for human use.
Isotype IgG1, lambda2
Clonality Monoclonal Antibody
Product name Indenebart Biosimilar - Anti-Alpha-synuclein mAb - Research Grade
Uniprot ID P37840
Source CAS: 2864437-88-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2167-100
Note For research use only. Not suitable for human use.
Isotype IgG1, lambda2
Clonality Monoclonal Antibody

Introduction

Indenebart Biosimilar – Anti-Alpha-synuclein mAb is a therapeutic antibody that has been developed as a biosimilar to an existing monoclonal antibody (mAb) targeting alpha-synuclein. This biosimilar is designed to mimic the structure and function of the original mAb, while also providing potential benefits such as increased accessibility and affordability for patients.

Structure of Indenebart Biosimilar – Anti-Alpha-synuclein mAb

Indenebart Biosimilar – Anti-Alpha-synuclein mAb is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a structure similar to natural antibodies found in the body. It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions are responsible for binding to the target molecule, alpha-synuclein, while the constant regions provide stability and effector functions.

The structure of Indenebart Biosimilar – Anti-Alpha-synuclein mAb is carefully engineered to ensure specificity and high affinity binding to alpha-synuclein. This is achieved through the use of advanced technologies such as phage display and recombinant DNA techniques, which allow for the selection and optimization of the antibody sequence.

Activity of Indenebart Biosimilar – Anti-Alpha-synuclein mAb

The primary activity of Indenebart Biosimilar – Anti-Alpha-synuclein mAb is to bind to and neutralize alpha-synuclein, a protein that plays a key role in the development of neurodegenerative diseases such as Parkinson’s and Alzheimer’s. In these diseases, alpha-synuclein aggregates and forms toxic clumps in the brain, leading to neuronal damage and ultimately, cognitive and motor dysfunction.

By binding to alpha-synuclein, Indenebart Biosimilar – Anti-Alpha-synuclein mAb prevents the formation of these toxic aggregates and promotes their clearance from the brain. This not only helps to slow or halt disease progression, but also has the potential to improve symptoms and quality of life for patients.

Application of Indenebart Biosimilar – Anti-Alpha-synuclein mAb

Indenebart Biosimilar – Anti-Alpha-synuclein mAb is currently being developed for use as a therapeutic antibody in the treatment of Parkinson’s and other neurodegenerative diseases. It is intended for use in patients who have already been diagnosed with these conditions, and may also have potential as a preventive treatment for individuals at high risk of developing these diseases.

The biosimilar nature of Indenebart Biosimilar – Anti-Alpha-synuclein mAb means that it has the potential to provide significant cost savings compared to the original mAb. This could make it more accessible to a wider range of patients, particularly in developing countries where access to expensive biologic therapies is limited.

Conclusion

In summary, Indenebart Biosimilar – Anti-Alpha-synuclein mAb is a promising therapeutic antibody that has been developed as a biosimilar to an existing mAb targeting alpha-synuclein. Its carefully engineered structure and high affinity binding to alpha-synuclein make it a potentially effective treatment for neurodegenerative diseases such as Parkinson’s. Its biosimilar nature also offers the potential for increased accessibility and affordability for patients. Further research and clinical trials will be needed to fully evaluate the efficacy and safety of Indenebart Biosimilar – Anti-Alpha-synuclein mAb, but it holds great promise as a therapeutic option for these devastating diseases.

SDS-PAGE for Indenebart Biosimilar - Research Grade

SDS-PAGE for Indenebart Biosimilar - Research Grade

Indenebart Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Indenebart Biosimilar – Anti-Alpha-synuclein mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products