Brand: ProteoGenix

Siltuximab Biosimilar – Anti-IL6 mAb – Research Grade

PX-TA1029-100UG
Validated ELISA WB

Isotype:: IgG1, kappa

Original price was: €254.00.Current price is: €200.00.

100ug 21% OFF + 200 loyalty points

Siltuximab Anti-IL6 Monoclonal Antibody for Cytokine Research

Size Size

50ug Original price was: €171.00.Current price is: €140.00.
100ug Original price was: €254.00.Current price is: €200.00.
1MG Original price was: €498.00.Current price is: €405.00.

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Siltuximab Biosimilar - Anti-IL6 mAb

Siltuximab Biosimilar- Anti-IL6 mAb binds to Human IL6 in indirect ELISA assay

Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade

Product name	Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID	P05231
Source	DrugBank DB09036
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight	145kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Siltuximab,Siltuximab,IL6,anti-IL6
Reference	PX-TA1029
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1Kappa
Clonality	Monoclonal Antibody

Product name	Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID	P05231
Source	DrugBank DB09036
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight	145kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Siltuximab,Siltuximab,IL6,anti-IL6
Reference	PX-TA1029
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1Kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1029-50
Uniprot ID	P05231
Source	DrugBank DB09036
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight	145kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Siltuximab,Siltuximab,IL6,anti-IL6
Reference	PX-TA1029
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa

General Information on Siltuximab Anti-IL6 Monoclonal Antibody

The Siltuximab antibody is a chimeric mouse/human monoclonal antibody designed to bind human interleukin-6 (IL-6), a soluble glycoprotein involved in pro-inflammatory signaling pathways.

Siltuximab is widely studied in research involving cytokine signaling, immune response regulation and inflammatory mechanisms. IL-6 is one of the major pro-inflammatory cytokines overexpressed in multiple pathological conditions and is produced by several cell types including T cells, B cells, monocytes, fibroblasts and endothelial cells.

By interacting with membrane-bound or soluble IL-6 receptors (IL6R), IL-6 can trigger multiple biological responses such as B-cell proliferation, vascular endothelial growth factor (VEGF) production and immune system dysregulation.

Siltuximab has been investigated in research related to inflammatory diseases, oncology and cytokine-mediated pathways, including studies involving multicentric Castleman disease (MCD), multiple myeloma and immune response dysregulation

Applications

This anti-IL6 monoclonal antibody is suitable for:

cytokine signaling studies
ELISA and binding assays
antibody characterization
immunology research
inflammation-related studies
cell-based assays

This Siltuximab biosimilar anti-IL6 monoclonal antibody is intended for research use only.

SDS-PAGE for Siltuximab Biosimilar - Anti-IL6 mAb

Siltuximab Biosimilar - Anti-IL6 mAb, on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Siltuximab Biosimilar- Anti-IL6 mAb binds to Human IL6 in indirect ELISA assay

Immobilized Human IL6 Recombinant Protein (cat. No.PX-P3013) at 0.5µg/mL (100µL/well) can bind Siltuximab Biosimilar- Anti-IL6 mAb (cat. No.PX-TA1029) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 62.18M.