Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Batoclimab Biosimilar – Anti-FCGRT mAb – Research Grade

  • PX-TA1581-50
  • Validated ELISA FC
Isotype:
IgG1, lambda

Original price was: €112.00.Current price is: €84.00.

50ug 25% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade

Product name Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name PX-TA1581-50
Uniprot ID P55899
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody

Introduction

Batoclimab Biosimilar is a novel therapeutic antibody that targets the FCGRT protein. This biosimilar is a monoclonal antibody (mAb) that has been designed to mimic the structure and function of the original Batoclimab antibody. In this article, we will discuss the structure, activity, and potential applications of Batoclimab Biosimilar as a research grade antibody.

Structure of Batoclimab Biosimilar

Batoclimab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that has been designed to target the neonatal Fc receptor (FCGRT). The antibody is composed of two heavy chains and two light chains, each consisting of a variable region and a constant region. The variable regions are responsible for binding to the FCGRT protein, while the constant regions determine the antibody’s effector functions.

Activity of Batoclimab Biosimilar

The primary activity of Batoclimab Biosimilar is its ability to bind to the FCGRT protein. FCGRT is a receptor found on the surface of cells that plays a crucial role in the recycling and transport of immunoglobulins (antibodies). By binding to FCGRT, Batoclimab Biosimilar can block the interaction between FCGRT and immunoglobulins, thereby preventing their recycling and leading to their degradation.

In addition to its primary activity, Batoclimab Biosimilar also has secondary activities that are dependent on its constant regions. These include antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These effector functions allow Batoclimab Biosimilar to recruit immune cells and activate the complement system to eliminate cells that express FCGRT, such as tumor cells.

Application of Batoclimab Biosimilar

As a research grade antibody, Batoclimab Biosimilar has a wide range of potential applications. One of its main uses is in studying the role of FCGRT in various diseases and conditions. FCGRT has been implicated in autoimmune diseases, cancer, and infectious diseases, making Batoclimab Biosimilar a valuable tool for understanding the mechanisms underlying these conditions.

Batoclimab Biosimilar can also be used in preclinical and clinical studies to evaluate its potential as a therapeutic antibody. By blocking FCGRT, this biosimilar has the potential to treat diseases where FCGRT plays a pathogenic role. For example, in autoimmune diseases, FCGRT can prolong the half-life of autoantibodies, leading to increased tissue damage. By inhibiting FCGRT, Batoclimab Biosimilar can reduce the levels of these autoantibodies and potentially alleviate disease symptoms.

Moreover, Batoclimab Biosimilar can also be used in combination with other therapeutic antibodies to improve their efficacy. For instance, in cancer treatment, combining Batoclimab Biosimilar with an anti-tumor antibody can enhance the immune response against tumor cells and improve treatment outcomes.

Conclusion

In summary, Batoclimab Biosimilar is a research grade antibody that targets the FCGRT protein. Its unique structure and activity make it a valuable tool for studying the role of FCGRT in various diseases and conditions. Additionally, Batoclimab Biosimilar has the potential to be developed as a therapeutic antibody for the treatment of diseases where FCGRT plays a pathogenic role. Further research and clinical studies are needed to fully explore the potential of this biosimilar as a therapeutic agent.

Flow Cytometry results for Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade

Flow Cytometry results for Batoclimab  Biosimilar - Anti-FCGRT mAb - Research Grade

Flow-cytometry using FITC anti-human FCGRT antibody. U937 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human FCGRT monoclonal antibody (Catalog: PX-TA1581, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade in ELISA Assay

Batoclimab  Biosimilar - Anti-FCGRT mAb - Research Grade in ELISA Assay

Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Batoclimab  Biosimilar - Anti-FCGRT mAb - Research Grade

There are no reviews yet.

Be the first to review “Batoclimab Biosimilar – Anti-FCGRT mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products