Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cinpanemab Biosimilar – Anti-SNCA mAb – Research Grade

  • PX-TA1573-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cinpanemab Biosimilar - Anti-SNCA mAb - Research Grade

Product name Cinpanemab Biosimilar - Anti-SNCA mAb - Research Grade
Uniprot ID P37840
Source CAS 2094516-02-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Cinpanemab ,BIIB-054,SNCA ,anti-SNCA
Reference PX-TA1573
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Cinpanemab Biosimilar - Anti-SNCA mAb - Research Grade
Uniprot ID P37840
Source CAS 2094516-02-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Cinpanemab ,BIIB-054,SNCA ,anti-SNCA
Reference PX-TA1573
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1573-50
Uniprot ID P37840
Source CAS 2094516-02-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Cinpanemab ,BIIB-054,SNCA ,anti-SNCA
Reference PX-TA1573
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Cinpanemab Biosimilar, also known as Anti-SNCA mAb, is a novel monoclonal antibody that has shown promising results in the treatment of various neurodegenerative diseases. This biosimilar is a research grade version of the original Cinpanemab, which is currently undergoing clinical trials for its therapeutic potential. In this article, we will delve into the structure, activity, and application of Cinpanemab Biosimilar as an antibody targeting SNCA, a key therapeutic target in neurodegenerative disorders.

Structure of Cinpanemab Biosimilar

Cinpanemab Biosimilar is a monoclonal antibody, meaning it is produced by a single clone of immune cells. It is a humanized IgG1 antibody, which means it has been engineered to have a human-like structure to reduce the risk of immune reactions. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains have two constant regions (CL) and one variable region (VL). The variable regions of the antibody are responsible for binding to the target molecule, SNCA.

Activity of Cinpanemab Biosimilar

The main activity of Cinpanemab Biosimilar is to bind to and neutralize SNCA, a protein that plays a crucial role in the pathogenesis of neurodegenerative diseases such as Parkinson’s disease, dementia with Lewy bodies, and multiple system atrophy. SNCA is a key component of Lewy bodies, abnormal protein aggregates that are found in the brains of patients with these disorders. These aggregates are thought to contribute to neuronal dysfunction and cell death.

Cinpanemab Biosimilar specifically targets the N-terminal region of SNCA, which is known to be involved in the aggregation and toxicity of the protein. By binding to this region, the antibody prevents SNCA from forming aggregates and reduces its toxicity, thereby potentially slowing down the progression of neurodegeneration.

Application of Cinpanemab Biosimilar

Cinpanemab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential as a therapeutic agent for neurodegenerative diseases. The primary application of this antibody is in the treatment of Parkinson’s disease, a progressive disorder characterized by the loss of dopaminergic neurons in the brain. By targeting SNCA, Cinpanemab Biosimilar has the potential to slow down the progression of the disease and improve motor symptoms.

In addition to Parkinson’s disease, Cinpanemab Biosimilar may also have applications in other neurodegenerative disorders such as dementia with Lewy bodies and multiple system atrophy. These disorders share similar pathological features with Parkinson’s disease and are also characterized by the presence of Lewy bodies.

Conclusion

In summary, Cinpanemab Biosimilar is a research grade monoclonal antibody that targets SNCA, a key therapeutic target in neurodegenerative diseases. Its structure, activity, and potential applications make it a promising candidate for the treatment of Parkinson’s disease and other related disorders. Further research and clinical trials will shed more light on the efficacy and safety of this antibody, and it may become a valuable addition to the current treatment options for neurodegenerative diseases.

SDS-PAGE for Cinpanemab Biosimilar - Anti-SNCA mAb - Research Grade

SDS-PAGE for Cinpanemab  Biosimilar - Anti-SNCA  mAb - Research Grade

Cinpanemab Biosimilar - Anti-SNCA mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

SEC-HPLC of Cinpanemab Biosimilar - Anti-SNCA mAb - Research Grade

SEC-HPLC of Cinpanemab  Biosimilar - Anti-SNCA  mAb - Research Grade

Cinpanemab Biosimilar - Anti-SNCA mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Cinpanemab  Biosimilar - Anti-SNCA  mAb - Research Grade

There are no reviews yet.

Be the first to review “Cinpanemab Biosimilar – Anti-SNCA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products