Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sacituzumab Biosimilar – Anti-TACSTD2 mAb – Research Grade

  • PX-TA1447-50
  • Validated ELISA FC
Isotype:
IgG1, kappa

Original price was: €118.00.Current price is: €84.00.

50ug 29% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Product name PX-TA1447-50
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

Sacituzumab Biosimilar – Anti-TACSTD2 mAb: A Promising Therapeutic Antibody Targeting TACSTD2 Sacituzumab Biosimilar, also known as Anti-TACSTD2 mAb, is a monoclonal antibody that has shown promising results in targeting TACSTD2, a cell surface protein that is overexpressed in various types of cancer. This biosimilar is a highly specific and potent therapeutic agent that has the potential to revolutionize cancer treatment.

Structure of Sacituzumab Biosimilar

Sacituzumab Biosimilar is a chimeric monoclonal antibody, meaning it is composed of both human and mouse components. The antibody is made up of two heavy chains and two light chains, with a total molecular weight of approximately 150 kDa. The heavy chains are composed of constant and variable regions, while the light chains only have variable regions. The variable regions are responsible for recognizing and binding to the target protein, TACSTD2.

The constant regions of Sacituzumab Biosimilar are derived from human antibodies, which reduces the likelihood of immune reactions in patients. The variable regions, on the other hand, are derived from mouse antibodies, which provides the antibody with high affinity and specificity for TACSTD2.

Activity of Sacituzumab Biosimilar

Sacituzumab Biosimilar works by binding to TACSTD2 on the surface of cancer cells, leading to a cascade of events that ultimately results in the destruction of these cells. The binding of the antibody to TACSTD2 triggers the immune system to attack and kill the cancer cells. Additionally, Sacituzumab Biosimilar also blocks the signaling pathways that promote cancer cell growth and survival, further inhibiting tumor growth.

Studies have shown that Sacituzumab Biosimilar has a high binding affinity for TACSTD2, making it a potent therapeutic agent. It has also been found to have minimal off-target effects, meaning it specifically targets cancer cells without harming healthy cells.

Application of Sacituzumab Biosimilar

Sacituzumab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various types of cancer, including breast, lung, and colorectal cancer. It has also shown potential in treating other types of solid tumors that overexpress TACSTD2.

The biosimilar is currently being evaluated in phase III clinical trials for the treatment of metastatic triple-negative breast cancer, a type of breast cancer that has limited treatment options. It has also shown promising results in early clinical trials for the treatment of other types of cancer.

In addition to its potential as a standalone therapy, Sacituzumab Biosimilar also has the potential to be used in combination with other cancer treatments, such as chemotherapy and radiation therapy. This could potentially enhance the efficacy of these treatments and improve patient outcomes.

Conclusion

Sacituzumab Biosimilar, also known as Anti-TACSTD2 mAb, is a highly specific and potent therapeutic antibody that targets the cell surface protein TACSTD2. Its unique structure and mechanism of action make it a promising treatment option for various types of cancer. With ongoing clinical trials and further research, Sacituzumab Biosimilar has the potential to significantly improve cancer treatment and patient outcomes.

SDS-PAGE for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

SDS-PAGE for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Immobilized Tumor-associated calcium signal transducer 2(TACSTD2) (cat. No.PX-P4569) at 0.5µg/mL (100µL/well) can bind to Sacituzumab Biosimilar - Anti-TACSTD2 mAb (cat. No.PX-TA1447) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Sacituzumab Biosimilar – Anti-TACSTD2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products