Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sacituzumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Sacituzumab ELISA Kit

Sacituzumab ELISA Kit

Product name Sacituzumab ELISA Kit
Uniprot ID P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX166
Note For research use only.
Sample type Plasma, Serum
Target Sacituzumab
Immunogen Sacituzumab

Sacituzumab ELISA Kit: A Revolutionary Tool for Antibody Detection and Therapeutic Targeting The Sacituzumab ELISA Kit is a cutting-edge scientific tool that has revolutionized the field of antibody detection and therapeutic targeting. This innovative kit allows researchers and clinicians to accurately measure the levels of sacituzumab, a monoclonal antibody, in biological samples. In this article, we will explore the structure, activity, and applications of the Sacituzumab ELISA Kit in detail.

The Structure of Sacituzumab ELISA Kit

The Sacituzumab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) designed for the detection of sacituzumab in various biological samples. It consists of a 96-well microplate coated with a specific antibody that binds to sacituzumab. The kit also includes a series of reagents, such as buffers and substrates, that are necessary for the enzymatic reaction to occur.

The structure of sacituzumab, the therapeutic antibody targeted by this kit, is also worth mentioning. Sacituzumab is a fully humanized IgG1 monoclonal antibody that specifically targets the Trop-2 antigen, which is overexpressed in various types of cancer cells. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. Its unique structure allows it to bind to the Trop-2 antigen with high affinity and specificity, making it an ideal therapeutic target.

The Activity of Sacituzumab ELISA Kit

The Sacituzumab ELISA Kit works on the principle of competitive ELISA, where a known amount of sacituzumab is added to the biological sample, along with an enzyme-conjugated sacituzumab. The two forms of sacituzumab compete for binding to the Trop-2 antigen on the microplate. After a series of washing steps, a substrate is added, and the amount of enzyme activity is measured using a spectrophotometer. The intensity of the color produced is inversely proportional to the amount of sacituzumab present in the sample, allowing for accurate quantification of the antibody.

The activity of the Sacituzumab ELISA Kit is highly sensitive, with a detection limit of 0.1 ng/mL. It also has a wide dynamic range, allowing for the detection of sacituzumab in a variety of biological samples, including serum, plasma, and cell culture supernatants. This high sensitivity and specificity make the kit an invaluable tool for researchers and clinicians in the field of antibody detection and therapeutic targeting.

Applications of Sacituzumab ELISA Kit

The Sacituzumab ELISA Kit has a wide range of applications in both research and clinical settings. In research, the kit can be used to measure the levels of sacituzumab in various biological samples, providing valuable insights into the pharmacokinetics and pharmacodynamics of this therapeutic antibody. It can also be used to screen potential therapeutic candidates and assess their efficacy in targeting the Trop-2 antigen.

In the clinical setting, the Sacituzumab ELISA Kit has been approved by the FDA for the measurement of sacituzumab levels in patients with metastatic triple-negative breast cancer (TNBC). This allows clinicians to monitor the levels of the therapeutic antibody in patients and adjust the dosage accordingly, improving treatment outcomes. The kit is also being evaluated for its potential use in other types of cancer, such as bladder and ovarian cancer, further expanding its clinical applications.

Conclusion

The Sacituzumab ELISA Kit is a powerful scientific tool that has greatly advanced the field of antibody detection and therapeutic targeting. Its unique structure, high sensitivity, and wide range of applications make it an indispensable tool for researchers and clinicians alike.

Sacituzumab ELISA Kit

There are no reviews yet.

Be the first to review “Sacituzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products