Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Tumor-associated calcium signal transducer 2(TACSTD2)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P09758
Molecular weight:
35-45kDa

€210.00

50ug + 210 loyalty points
Met1–Thr274 His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Tumor-associated calcium signal transducer 2(TACSTD2)

Product name Tumor-associated calcium signal transducer 2(TACSTD2)
Uniprot ID P09758
Uniprot link https://www.uniprot.org/uniprot/P09758
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Molecular weight 35-45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr274
Protein Accession P09758
Spec:Entrez GeneID 4070
Spec:NCBI Gene Aliases EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Spec:SwissProtID Q15658
NCBI Reference P09758
Aliases /Synonyms GA733-1, M1S1, TROP2,Cell surface glycoprotein Trop-2；Membrane component chromosome 1 surface marker 1；Pancreatic carcinoma marker protein GA733-1
Reference PX-P4569
Note For research use only
Molecular Constructor
Met1–Thr274 His
Product name Tumor-associated calcium signal transducer 2(TACSTD2)
Uniprot ID P09758
Uniprot link https://www.uniprot.org/uniprot/P09758
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Molecular weight 35-45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr274
Protein Accession P09758
Spec:Entrez GeneID 4070
Spec:NCBI Gene Aliases EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Spec:SwissProtID Q15658
NCBI Reference P09758
Aliases /Synonyms GA733-1, M1S1, TROP2,Cell surface glycoprotein Trop-2；Membrane component chromosome 1 surface marker 1；Pancreatic carcinoma marker protein GA733-1
Reference PX-P4569
Note For research use only
Molecular Constructor
Met1–Thr274 His

Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Immobilized Tumor-associated calcium signal transducer 2(TACSTD2) (cat. No.PX-P4569) at 0.5µg/mL (100µL/well) can bind to Sacituzumab Biosimilar - Anti-TACSTD2 mAb (cat. No.PX-TA1447) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “Tumor-associated calcium signal transducer 2(TACSTD2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products