Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Risankizumab Biosimilar – Anti-IL23A mAb – Research Grade

  • PX-TA1396-100UG
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €276.00.Current price is: €200.00.

100ug 28% OFF + 200 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Risankizumab Biosimilar - Anti-IL23A mAb
Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay
Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade

Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade

Product name Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1612838-76-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Risankizumab,BI 655066,risankizumab-rzaa,IL23A,anti-IL23A
Reference PX-TA1396
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1612838-76-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Risankizumab,BI 655066,risankizumab-rzaa,IL23A,anti-IL23A
Reference PX-TA1396
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1396-50
Uniprot ID Q9NPF7
Source CAS 1612838-76-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Risankizumab,BI 655066,risankizumab-rzaa,IL23A,anti-IL23A
Reference PX-TA1396
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL23A[Homo sapiens] (Risankizumab) Monoclonal Antibody

Risankizumab is a humanized IgG1 monoclonal antibody (mAb) that targets interleukin 23 (IL-23). It has been used for the treatment of moderate-to-severe plaque psoriasis

SDS-PAGE for Risankizumab Biosimilar - Anti-IL23A mAb

SDS-PAGE for Risankizumab Biosimilar - Anti-IL23A mAb

Risankizumab Biosimilar - Anti-IL23A mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay

Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay

Human IL23A recombinant protein(cat. No.PX-P5123) at 0.5µg/mL (100µL/well) can bind Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Risankizumab Biosimilar - Anti-IL23A mAb - Research Grade

There are no reviews yet.

Be the first to review “Risankizumab Biosimilar – Anti-IL23A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products