Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Marstacimab Biosimilar – Anti-TFPI mAb – Research Grade

  • PX-TA1529-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

Product name Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Source CAS 1985638-39-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Marstacimab,PF-06741086,TFPI,anti-TFPI
Reference PX-TA1529
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Source CAS 1985638-39-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Marstacimab,PF-06741086,TFPI,anti-TFPI
Reference PX-TA1529
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1529-50
Uniprot ID P10646
Source CAS 1985638-39-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Marstacimab,PF-06741086,TFPI,anti-TFPI
Reference PX-TA1529
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Marstacimab Biosimilar, also known as Anti-TFPI mAb, is a monoclonal antibody that has been developed as a biosimilar to the existing therapeutic antibody, Marstacimab. It is a promising therapeutic option for the treatment of various diseases and conditions, and its structure, activity and applications have been extensively studied and researched. In this article, we will delve into the details of Marstacimab Biosimilar, exploring its structure, mechanism of action, and potential therapeutic applications.

Structure of Marstacimab Biosimilar

Marstacimab Biosimilar is a monoclonal antibody that specifically targets Tissue Factor Pathway Inhibitor (TFPI), a protein that plays a crucial role in regulating blood coagulation. The antibody is composed of two identical heavy chains and two identical light chains, linked together by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of one constant domain (CL) and one variable domain (VL). The variable domains are responsible for binding to the target protein, TFPI, while the constant domains provide structural stability and effector functions.

Mechanism of Action

Marstacimab Biosimilar works by binding to TFPI and inhibiting its activity. TFPI is a natural inhibitor of Factor Xa, a key enzyme involved in the coagulation cascade. By binding to TFPI, Marstacimab Biosimilar prevents it from inhibiting Factor Xa, leading to increased levels of Factor Xa and ultimately promoting blood coagulation. This mechanism of action makes Marstacimab Biosimilar a potent anticoagulant, with potential applications in various diseases and conditions characterized by abnormal blood clotting.

Therapeutic Applications

Marstacimab Biosimilar has been studied for its potential therapeutic applications in various diseases and conditions. One of the most promising applications is in the treatment of hemophilia, a genetic disorder characterized by a deficiency in clotting factors, leading to excessive bleeding. By inhibiting TFPI, Marstacimab Biosimilar can promote blood clotting and reduce the risk of bleeding episodes in patients with hemophilia. Clinical trials have shown promising results, and the antibody is currently being evaluated for its efficacy and safety in hemophilia patients.

In addition to hemophilia, Marstacimab Biosimilar has also shown potential in the treatment of other bleeding disorders, such as von Willebrand disease and thrombocytopenia. It has also been studied for its potential use in preventing blood clots in patients with conditions such as deep vein thrombosis and pulmonary embolism. Furthermore, Marstacimab Biosimilar has shown promise in the treatment of certain types of cancer, where abnormal blood clotting is often a complication.

Conclusion

In summary, Marstacimab Biosimilar is a monoclonal antibody with a specific and potent mechanism of action against TFPI. Its structure, activity, and potential therapeutic applications have been extensively studied, making it a promising option for the treatment of various diseases and conditions. With ongoing research and clinical trials, Marstacimab Biosimilar has the potential to significantly improve the lives of patients suffering from bleeding disorders and other conditions characterized by abnormal blood clotting.

SDS-PAGE for Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

SDS-PAGE for Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

SEC-HPLC of Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

Marstacimab Biosimilar - Anti-TFPI mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

There are no reviews yet.

Be the first to review “Marstacimab Biosimilar – Anti-TFPI mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products