Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Orilanolimab Biosimilar – Anti-FCGRT mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Orilanolimab Biosimilar - Anti-FCGRT mAb - Research Grade

Product name Orilanolimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Source CAS 2066544-85-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Orilanolimab,SYNT-001,FCGRT,anti-FCGRT
Reference PX-TA1531
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Orilanolimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Source CAS 2066544-85-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Orilanolimab,SYNT-001,FCGRT,anti-FCGRT
Reference PX-TA1531
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1531-50
Uniprot ID P55899
Source CAS 2066544-85-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Orilanolimab,SYNT-001,FCGRT,anti-FCGRT
Reference PX-TA1531
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

The Structure of Orilanolimab Biosimilar – Anti-FCGRT mAb

Orilanolimab Biosimilar is a monoclonal antibody (mAb) that targets the Fc-gamma receptor (FCGR) recycling protein (FCGRT). It is a research grade antibody that has been developed as a biosimilar to the original Orilanolimab, which is used as a therapeutic drug for autoimmune diseases. The biosimilar version has been designed to have a similar structure and function to the original, but at a lower cost.

The structure of Orilanolimab Biosimilar is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains have a molecular weight of approximately 50 kDa, while the light chains have a molecular weight of approximately 25 kDa. The overall molecular weight of the antibody is approximately 150 kDa.

The heavy chains of Orilanolimab Biosimilar contain four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains contain two constant domains (CL and CL2) and one variable domain (VL). The variable domains are responsible for binding to the target protein, FCGRT.

The Activity of Orilanolimab Biosimilar – Anti-FCGRT mAb

The primary activity of Orilanolimab Biosimilar is its ability to bind to FCGRT with high specificity and affinity. FCGRT is a protein that is expressed on the surface of cells in the immune system, including B cells and macrophages. It plays a crucial role in the recycling of immunoglobulin G (IgG) antibodies, which are important components of the immune response.

By binding to FCGRT, Orilanolimab Biosimilar blocks the recycling of IgG antibodies, leading to a decrease in the levels of these antibodies in the body. This can be beneficial in autoimmune diseases, where the immune system mistakenly attacks the body’s own tissues. By reducing the levels of IgG antibodies, Orilanolimab Biosimilar helps to decrease the immune response and prevent damage to the body’s tissues.

Orilanolimab Biosimilar also has anti-inflammatory properties, which can further contribute to its therapeutic effects. It has been shown to inhibit the production of pro-inflammatory cytokines, such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α), which play a role in the development of autoimmune diseases.

The Application of Orilanolimab Biosimilar – Anti-FCGRT mAb

Orilanolimab Biosimilar has potential applications in the treatment of various autoimmune diseases, including rheumatoid arthritis, systemic lupus erythematosus, and psoriasis. It can also be used in the management of immune-mediated disorders, such as immune thrombocytopenia and hemolytic anemia.

As a research grade antibody, Orilanolimab Biosimilar can also be used in laboratory studies to investigate the role of FCGRT in the immune system and its potential as a therapeutic target. It can be used in cell-based assays to study the binding and activity of the antibody, as well as in animal models to evaluate its efficacy and safety.

In addition, Orilanolimab Biosimilar can be used as a biosimilar to the original Orilanolimab in clinical trials. This can provide a more affordable alternative for patients and potentially increase access to this effective treatment.

Conclusion

In summary, Orilanolimab Biosimilar is a research grade monoclonal antibody that targets the FCGRT protein in the immune system. Its structure consists of two heavy chains and two light chains, with variable domains responsible for binding to FCGRT. Its primary activity is the inhibition of IgG recycling, which can be beneficial in autoimmune diseases. Its potential applications include the treatment of autoimmune diseases and immune-mediated disorders, as well as its use in laboratory studies and clinical trials.

SDS-PAGE for Orilanolimab Biosimilar - Anti-FCGRT;FCRN mAb - Research Grade

SDS-PAGE for Orilanolimab Biosimilar - Anti-FCGRT;FCRN mAb - Research Grade

Orilanolimab Biosimilar - Anti-FCGRT;FCRN mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Orilanolimab Biosimilar - Anti-FCGRT mAb - Research Grade

There are no reviews yet.

Be the first to review “Orilanolimab Biosimilar – Anti-FCGRT mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products