Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD62L/SELL Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P18337
Molecular weight:
33.67 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Thr40–Thr319
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD62L/SELL Protein, N-His

Product name ARO-P10603-100
Uniprot ID P18337
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQET
Molecular weight 33.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Thr319
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-P10603
Note For research use only.
Molecular Constructor
Thr40–Thr319
Product name ARO-P10603-1MG
Uniprot ID P18337
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQET
Molecular weight 33.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Thr319
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-P10603
Note For research use only.
Molecular Constructor
Thr40–Thr319
Product name ARO-P10603-50
Uniprot ID P18337
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQET
Molecular weight 33.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Thr319
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-P10603
Note For research use only.
Molecular Constructor
Thr40–Thr319

Introduction

Recombinant Mouse CD62L/SELL Protein, also known as L-selectin, is a glycoprotein that plays a critical role in the immune system. It is a member of the selectin family of cell adhesion molecules and is primarily expressed on the surface of leukocytes, including lymphocytes and monocytes. This protein is involved in the process of leukocyte trafficking, which is essential for immune surveillance and response. In this article, we will discuss the structure, activity, and application of Recombinant Mouse CD62L/SELL Protein.

Structure

Recombinant Mouse CD62L/SELL Protein is a type I transmembrane protein with a molecular weight of approximately 74 kDa. It is composed of a large extracellular domain, a transmembrane domain, and a short cytoplasmic tail. The extracellular domain contains a lectin-like domain, an EGF-like domain, and a series of repeating units called sushi domains. These domains are responsible for the binding of CD62L to its ligands, which include GlyCAM-1, CD34, and MAdCAM-1. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic tail is involved in signal transduction.

Activity

The primary function of Recombinant Mouse CD62L/SELL Protein is to mediate the adhesion of leukocytes to the endothelium of blood vessels. This process is crucial for the recruitment of immune cells to sites of infection or inflammation. CD62L achieves this by binding to its ligands on the surface of endothelial cells, which triggers a cascade of events leading to the firm adhesion and subsequent transmigration of leukocytes into the affected tissue.

In addition to its role in leukocyte trafficking, CD62L also plays a role in regulating the activation and survival of lymphocytes. Studies have shown that engagement of CD62L can enhance the activation of T cells and promote their survival. This is achieved through the recruitment of signaling molecules to the cytoplasmic tail of CD62L, which leads to the activation of various signaling pathways.

Application

Recombinant Mouse CD62L/SELL Protein has various applications in both research and therapeutic settings. In research, this protein is commonly used as a tool to study the mechanisms of leukocyte trafficking and immune cell activation. It can be used to investigate the role of CD62L in various immune responses, such as inflammation, infection, and autoimmunity.

In therapeutic applications, Recombinant Mouse CD62L/SELL Protein has shown potential as a target for the treatment of inflammatory diseases. For example, blocking the interaction between CD62L and its ligands has been shown to reduce the recruitment of leukocytes to inflamed tissues, thereby reducing tissue damage and inflammation. This approach has been explored in diseases such as rheumatoid arthritis and multiple sclerosis.

Furthermore, Recombinant Mouse CD62L/SELL Protein has also been used in the development of vaccines. By targeting CD62L, researchers can enhance the activation and survival of immune cells, leading to a more robust immune response against the vaccine antigen. This approach has been successful in the development of vaccines against various infectious diseases, including influenza and HIV.

Conclusion

In summary, Recombinant Mouse CD62L/SELL Protein is a crucial component of the immune system, involved in leukocyte trafficking, activation, and survival. Its structure, activity, and applications have been extensively studied and have provided valuable insights into the mechanisms of immune response and potential therapeutic interventions. With ongoing research, the potential of this protein in both research and therapeutic settings continues to expand.

Recombinant Mouse CD62L/SELL Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD62L/SELL Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products