Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse RTN4R Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q99PI8
Molecular weight:
34.06 kDa

Original price was: €276.00.Current price is: €230.00.

50ug 17% OFF + 230 loyalty points
Thr25–Gly308
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse RTN4R Protein, N-His

Product name ARO-P11040-100
Uniprot ID Q99PI8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEG
Molecular weight 34.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr25-Gly308
Aliases /Synonyms NgR1, Rtn4r, Nogo receptor, Nogor, Ngr1, Nogo66 receptor-1, Nogo-66 receptor, Reticulon-4 receptor, NgR
Reference ARO-P11040
Note For research use only.
Molecular Constructor
Thr25–Gly308
Product name ARO-P11040-1MG
Uniprot ID Q99PI8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEG
Molecular weight 34.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr25-Gly308
Aliases /Synonyms NgR1, Rtn4r, Nogo receptor, Nogor, Ngr1, Nogo66 receptor-1, Nogo-66 receptor, Reticulon-4 receptor, NgR
Reference ARO-P11040
Note For research use only.
Molecular Constructor
Thr25–Gly308
Product name ARO-P11040-50
Uniprot ID Q99PI8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEG
Molecular weight 34.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr25-Gly308
Aliases /Synonyms NgR1, Rtn4r, Nogo receptor, Nogor, Ngr1, Nogo66 receptor-1, Nogo-66 receptor, Reticulon-4 receptor, NgR
Reference ARO-P11040
Note For research use only.
Molecular Constructor
Thr25–Gly308

Introduction

The Recombinant Mouse RTN4R Protein is a highly purified protein that is produced through recombinant DNA technology. It is a member of the reticulon family of proteins, which are involved in various cellular processes such as membrane trafficking, endoplasmic reticulum (ER) function, and axonal regeneration. This protein has been extensively studied and has shown promising results in various applications.

Structure

The Recombinant Mouse RTN4R Protein is a transmembrane protein with a molecular weight of approximately 55 kDa. It contains a N-terminal cytoplasmic domain, a transmembrane domain, and a C-terminal extracellular domain. The extracellular domain contains three conserved domains: a hydrophobic region, a large loop, and a C-terminal tail. These domains are important for the protein’s function and interactions with other molecules.

Activity

The main activity of the Recombinant Mouse RTN4R Protein is its role in axonal regeneration. It is a receptor for the myelin-associated inhibitor, Nogo, which is a protein that inhibits axonal growth. When Nogo binds to RTN4R, it activates downstream signaling pathways that inhibit axonal regeneration. However, when the Recombinant Mouse RTN4R Protein is used, it acts as a competitive inhibitor, preventing Nogo from binding to the endogenous RTN4R and thus promoting axonal regeneration.

In addition to its role in axonal regeneration, the Recombinant Mouse RTN4R Protein has also been shown to play a role in ER function. It is involved in the formation and maintenance of the ER network, as well as the regulation of ER stress response. This protein has also been linked to the regulation of autophagy, a cellular process involved in the degradation of damaged or unnecessary cellular components.

Applications

The Recombinant Mouse RTN4R Protein has various applications in both research and therapeutic settings. Its most well-known application is in promoting axonal regeneration, making it a potential treatment for spinal cord injuries and other neurological disorders. It has also been studied for its potential in treating neurodegenerative diseases such as Alzheimer’s and Parkinson’s.

Furthermore, the Recombinant Mouse RTN4R Protein has been used in research to study its role in cellular processes such as ER function and autophagy. It has also been used to investigate the mechanisms of axonal regeneration and the potential of other molecules to promote or inhibit this process.

Conclusion

The Recombinant Mouse RTN4R Protein is a crucial protein involved in axonal regeneration and other cellular processes. Its structure, activity, and applications make it a valuable tool in both research and therapeutic settings. With further studies and advancements in technology, this protein has the potential to greatly impact the treatment of neurological disorders and contribute to a better understanding of cellular processes.

Recombinant Mouse RTN4R Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse RTN4R Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products