Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse LRPAP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P55302
Molecular weight:
27.55 kDa

Original price was: €258.00.Current price is: €230.00.

50ug 11% OFF + 230 loyalty points
Glu148–Leu360
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse LRPAP1 Protein, N-His

Product name ARO-P11037-100
Uniprot ID P55302
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ELGDPRLEKLWHKAKTSGKFSSEELDKLWREFLHYKEKIQEYNVLLDTLSRAEEGYENLLSPSDMAHIKSDTLISKHSELKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Molecular weight 27.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu148-Leu360
Aliases /Synonyms Alpha-2-macroglobulin receptor-associated protein, Low density lipoprotein receptor-related protein-associated protein 1, RAP, Lrpap1, Alpha-2-MRAP, HBP-44, Heparin-binding protein 44
Reference ARO-P11037
Note For research use only.
Molecular Constructor
Glu148–Leu360
Product name ARO-P11037-1MG
Uniprot ID P55302
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ELGDPRLEKLWHKAKTSGKFSSEELDKLWREFLHYKEKIQEYNVLLDTLSRAEEGYENLLSPSDMAHIKSDTLISKHSELKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Molecular weight 27.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu148-Leu360
Aliases /Synonyms Alpha-2-macroglobulin receptor-associated protein, Low density lipoprotein receptor-related protein-associated protein 1, RAP, Lrpap1, Alpha-2-MRAP, HBP-44, Heparin-binding protein 44
Reference ARO-P11037
Note For research use only.
Molecular Constructor
Glu148–Leu360
Product name ARO-P11037-50
Uniprot ID P55302
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ELGDPRLEKLWHKAKTSGKFSSEELDKLWREFLHYKEKIQEYNVLLDTLSRAEEGYENLLSPSDMAHIKSDTLISKHSELKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Molecular weight 27.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu148-Leu360
Aliases /Synonyms Alpha-2-macroglobulin receptor-associated protein, Low density lipoprotein receptor-related protein-associated protein 1, RAP, Lrpap1, Alpha-2-MRAP, HBP-44, Heparin-binding protein 44
Reference ARO-P11037
Note For research use only.
Molecular Constructor
Glu148–Leu360

Introduction

Recombinant Mouse LRPAP1 Protein, also known as low-density lipoprotein receptor-related protein-associated protein 1, is a key protein involved in the regulation of lipid metabolism and cellular signaling pathways. This protein is produced through recombinant technology, making it highly pure and suitable for various research applications. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse LRPAP1 Protein.

Structure of Recombinant Mouse LRPAP1 Protein

Recombinant Mouse LRPAP1 Protein is a 37 kDa protein consisting of 334 amino acids. It is composed of three domains: an N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain is responsible for binding to other proteins, while the central domain contains a conserved cysteine-rich region that is essential for protein-protein interactions. The C-terminal domain is involved in the regulation of LRP1-mediated endocytosis.

Activity of Recombinant Mouse LRPAP1 Protein

Recombinant Mouse LRPAP1 Protein plays a crucial role in the regulation of lipid metabolism and cellular signaling pathways. It acts as a chaperone protein, binding to and stabilizing the low-density lipoprotein receptor-related protein 1 (LRP1). LRP1 is a multifunctional cell surface receptor that is involved in the clearance of lipoproteins, cellular signaling, and endocytosis. Recombinant Mouse LRPAP1 Protein also interacts with other proteins, such as apolipoprotein E (apoE), to regulate their functions.

One of the key activities of Recombinant Mouse LRPAP1 Protein is its role in the regulation of cholesterol homeostasis. It binds to LRP1 and facilitates the clearance of cholesterol from the bloodstream by promoting its uptake into cells. This activity is essential for maintaining healthy cholesterol levels and preventing the development of cardiovascular diseases.

Moreover, Recombinant Mouse LRPAP1 Protein has been shown to modulate cellular signaling pathways. It interacts with LRP1 to regulate the activation of several signaling molecules, including the mitogen-activated protein kinase (MAPK) pathway. This pathway is involved in cell proliferation, differentiation, and survival, and its dysregulation has been linked to various diseases, such as cancer. Therefore, Recombinant Mouse LRPAP1 Protein may have potential applications in the treatment of these diseases by modulating the MAPK pathway.

Applications of Recombinant Mouse LRPAP1 Protein

Recombinant Mouse LRPAP1 Protein has a wide range of applications in biomedical research. It can be used as an antigen for the production of specific antibodies to study the function and regulation of LRP1. These antibodies can be used in various techniques, including Western blotting, immunoprecipitation, and immunofluorescence, to detect and quantify the expression of LRPAP1 in different tissues and cell types.

Furthermore, Recombinant Mouse LRPAP1 Protein can be used in in vitro and in vivo studies to investigate its role in cholesterol metabolism and cellular signaling pathways. It can be added to cell culture media to study its effects on cellular processes, such as cholesterol uptake and cellular signaling. In animal studies, Recombinant Mouse LRPAP1 Protein can be administered to investigate its potential therapeutic effects on diseases related to cholesterol metabolism and cellular signaling.

In addition, Recombinant Mouse LRPAP1 Protein has potential applications in drug discovery and development. Its role in regulating cholesterol levels and cellular signaling makes it an attractive target for the development of novel therapeutics. By modulating the activity of LRP1 and other signaling pathways, Recombinant Mouse LRPAP1 Protein may have potential applications in the treatment of various diseases, including cardiovascular diseases and cancer.

Conclusion

In summary, Recombinant Mouse LRPAP1 Protein is a key protein involved in the regulation of lipid metabolism and cellular signaling pathways. Its structure, activity, and potential applications make it

Recombinant Mouse LRPAP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse LRPAP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products