Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ASAH2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JHE3
Molecular weight:
15.77 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Glu641–Thr756
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ASAH2 Protein, N-His

Product name ARO-P11041-100
Uniprot ID Q9JHE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EYRVGEVVEVIFVGANPKNSAENQTHQTFLTVEKYEDSVADWQIMYNDASWETRFYWHKGILGLSNATIYWHIPDTAYPGIYRIRYFGHNRKQELLKPAVILAFEGISSPFEVVTT
Molecular weight 15.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu641-Thr756
Aliases /Synonyms Acylsphingosine deacylase 2, Neutral ceramidase, NCDase, N-acylsphingosine amidohydrolase 2, Asah2, N-CDase
Reference ARO-P11041
Note For research use only.
Molecular Constructor
Glu641–Thr756
Product name ARO-P11041-1MG
Uniprot ID Q9JHE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EYRVGEVVEVIFVGANPKNSAENQTHQTFLTVEKYEDSVADWQIMYNDASWETRFYWHKGILGLSNATIYWHIPDTAYPGIYRIRYFGHNRKQELLKPAVILAFEGISSPFEVVTT
Molecular weight 15.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu641-Thr756
Aliases /Synonyms Acylsphingosine deacylase 2, Neutral ceramidase, NCDase, N-acylsphingosine amidohydrolase 2, Asah2, N-CDase
Reference ARO-P11041
Note For research use only.
Molecular Constructor
Glu641–Thr756
Product name ARO-P11041-50
Uniprot ID Q9JHE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EYRVGEVVEVIFVGANPKNSAENQTHQTFLTVEKYEDSVADWQIMYNDASWETRFYWHKGILGLSNATIYWHIPDTAYPGIYRIRYFGHNRKQELLKPAVILAFEGISSPFEVVTT
Molecular weight 15.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu641-Thr756
Aliases /Synonyms Acylsphingosine deacylase 2, Neutral ceramidase, NCDase, N-acylsphingosine amidohydrolase 2, Asah2, N-CDase
Reference ARO-P11041
Note For research use only.
Molecular Constructor
Glu641–Thr756

Introduction

Recombinant Mouse ASAH2 Protein, also known as Acid Ceramidase 2, is a protein that plays a crucial role in the degradation of sphingolipids. This protein is produced through recombinant technology, making it a valuable tool in various scientific applications. In this article, we will explore the structure, activity, and applications of Recombinant Mouse ASAH2 Protein.

Structure of Recombinant Mouse ASAH2 Protein

Recombinant Mouse ASAH2 Protein is a 50 kDa protein that consists of 391 amino acids. It is a member of the N-acylsphingosine amidohydrolase (ASAH) family, which is responsible for the hydrolysis of ceramides into sphingosine and fatty acids. The protein contains a catalytic domain, a transmembrane domain, and a C-terminal domain. The catalytic domain is responsible for the enzymatic activity of ASAH2, while the transmembrane domain anchors the protein to the cellular membrane. The C-terminal domain is involved in protein-protein interactions and is essential for the proper functioning of the protein.

Activity of Recombinant Mouse ASAH2 Protein

Recombinant Mouse ASAH2 Protein is a highly active enzyme that plays a crucial role in sphingolipid metabolism. It catalyzes the hydrolysis of ceramides, which are essential components of cell membranes and play a role in various cellular processes such as cell signaling, proliferation, and apoptosis. The activity of ASAH2 is regulated by various factors, including pH, temperature, and the presence of cofactors. The optimal pH for ASAH2 activity is between 5.0 and 5.5, and the enzyme is active at temperatures ranging from 37-45°C. The presence of metal ions, such as zinc and magnesium, enhances the activity of ASAH2, while inhibitors, such as bisphosphonates, can inhibit its activity.

Applications of Recombinant Mouse ASAH2 Protein

Recombinant Mouse ASAH2 Protein has a wide range of applications in the field of biotechnology and medicine. Some of the key applications of this protein are:

1. Production of Antibodies

Recombinant Mouse ASAH2 Protein can be used as an antigen to produce specific antibodies. Antibodies produced against ASAH2 can be used for various research purposes, such as studying the expression and localization of the protein in different tissues and cells.

2. Drug Development

The overexpression of ASAH2 has been linked to various diseases, including cancer, neurodegenerative disorders, and metabolic disorders. Recombinant Mouse ASAH2 Protein can be used to screen potential drug candidates that can inhibit the activity of ASAH2 and thus, can be used for the treatment of these diseases.

3. Enzyme Replacement Therapy

Mutations in the ASAH2 gene can lead to a deficiency of the enzyme, resulting in a rare genetic disorder called Farber disease. Recombinant Mouse ASAH2 Protein can be used as a replacement therapy for individuals with this disorder, providing them with the functional enzyme and improving their quality of life.

4. Lipid Analysis

Recombinant Mouse ASAH2 Protein can be used in lipid analysis techniques, such as liquid chromatography-mass spectrometry (LC-MS), to quantify the levels of ceramides in biological samples. This can help in understanding the role of ASAH2 in various physiological and pathological processes.

5. Cell Signaling Studies

As mentioned earlier, ceramides play a crucial role in cell signaling. Recombinant Mouse ASAH2 Protein can be used to study the effects of ceramides on different signaling pathways and their role in various cellular processes.

Conclusion

Recombinant Mouse ASAH2 Protein is a valuable tool in

Recombinant Mouse ASAH2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ASAH2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products