Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLCO1B1/LST-1/OATP-2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6L6
Molecular weight:
12.45 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Phe426–Phe537
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLCO1B1/LST-1/OATP-2, N-His

Product name ARO-P12792-100
Uniprot ID Q9Y6L6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Molecular weight 12.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe426-Phe537
Aliases /Synonyms LST1, OATP1B1, OATP2, SLCO1B1, Solute carrier family 21 member 6, OATP-2, Sodium-independent organic anion-transporting polypeptide 2, LST-1, SLC21A6, OATP-C, OATPC, Solute carrier organic anion transporter family member 1B1, Liver-specific organic anion transporter 1
Reference ARO-P12792
Note For research use only.
Molecular Constructor
Phe426–Phe537
Product name ARO-P12792-1MG
Uniprot ID Q9Y6L6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Molecular weight 12.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe426-Phe537
Aliases /Synonyms LST1, OATP1B1, OATP2, SLCO1B1, Solute carrier family 21 member 6, OATP-2, Sodium-independent organic anion-transporting polypeptide 2, LST-1, SLC21A6, OATP-C, OATPC, Solute carrier organic anion transporter family member 1B1, Liver-specific organic anion transporter 1
Reference ARO-P12792
Note For research use only.
Molecular Constructor
Phe426–Phe537
Product name ARO-P12792-50
Uniprot ID Q9Y6L6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Molecular weight 12.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe426-Phe537
Aliases /Synonyms LST1, OATP1B1, OATP2, SLCO1B1, Solute carrier family 21 member 6, OATP-2, Sodium-independent organic anion-transporting polypeptide 2, LST-1, SLC21A6, OATP-C, OATPC, Solute carrier organic anion transporter family member 1B1, Liver-specific organic anion transporter 1
Reference ARO-P12792
Note For research use only.
Molecular Constructor
Phe426–Phe537

Introduction to Recombinant Human SLCO1B1/LST-1/OATP-2

Recombinant Human SLCO1B1/LST-1/OATP-2 is a protein that belongs to the organic anion transporting polypeptide (OATP) family. It is encoded by the SLCO1B1 gene and is also known as liver-specific transporter 1 (LST-1). This protein is primarily found in the liver, where it plays a crucial role in the uptake of various endogenous and exogenous compounds, including hormones, drugs, and toxins. Recombinant Human SLCO1B1/LST-1/OATP-2 is widely used in research and pharmaceutical industries for its ability to transport a wide range of substrates, making it an essential tool in drug discovery and development.

Structure of Recombinant Human SLCO1B1/LST-1/OATP-2

The SLCO1B1 gene is located on chromosome 12 and encodes a protein of 691 amino acids. Recombinant Human SLCO1B1/LST-1/OATP-2 has a molecular weight of approximately 77 kDa. It consists of 12 transmembrane domains, with both the N- and C-termini facing the cytoplasm. The transmembrane domains are connected by intracellular and extracellular loops, which are essential for substrate binding and transport. The protein also contains several glycosylation sites, which are crucial for its stability and proper functioning.

Activity of Recombinant Human SLCO1B1/LST-1/OATP-2

Recombinant Human SLCO1B1/LST-1/OATP-2 is a membrane-bound protein that acts as a transporter for a wide range of substrates, including bile acids, bilirubin, hormones, and drugs. It functions by actively transporting these compounds from the blood into the liver cells, where they can be further metabolized or excreted. This process is essential for maintaining the body’s homeostasis and protecting the liver from toxic substances.

The activity of Recombinant Human SLCO1B1/LST-1/OATP-2 is regulated by various factors, including genetic variations, drug-drug interactions, and disease states. Mutations in the SLCO1B1 gene can lead to altered transport activity, resulting in adverse drug reactions and increased risk of liver damage. Drug interactions can also affect the protein’s activity by either inhibiting or inducing its function, leading to changes in drug efficacy and toxicity. Additionally, certain diseases, such as liver cirrhosis, can also affect the expression and activity of Recombinant Human SLCO1B1/LST-1/OATP-2, further highlighting its importance in liver function and drug metabolism.

Applications of Recombinant Human SLCO1B1/LST-1/OATP-2

Recombinant Human SLCO1B1/LST-1/OATP-2 has numerous applications in both research and pharmaceutical industries. Its ability to transport a wide range of substrates makes it an important tool in drug discovery and development. It is commonly used in in vitro studies to assess drug uptake and metabolism in liver cells. This protein is also crucial in predicting drug-drug interactions and assessing the potential for drug-induced liver injury.

In addition to its role in drug research, Recombinant Human SLCO1B1/LST-1/OATP-2 is also used in diagnostic tests for liver diseases. Mutations in the SLCO1B1 gene have been linked to various liver disorders, including Gilbert syndrome and drug-induced liver injury. Therefore, testing for these mutations can help identify individuals at risk for adverse drug reactions and liver damage.

Furthermore, Recombinant Human SLCO1B1/LST-1/OATP-2 is also used in the production of

Recombinant Human SLCO1B1/LST-1/OATP-2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SLCO1B1/LST-1/OATP-2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products