Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CEP97 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IW35
Molecular weight:
23.18 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Val18–Asn205
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CEP97 Protein, N-His

Product name ARO-P12432-100
Uniprot ID Q8IW35
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNN
Molecular weight 23.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val18-Asn205
Aliases /Synonyms Cep97, Leucine-rich repeat and IQ domain-containing protein 2, LRRIQ2, CEP97, Centrosomal protein of 97 kDa
Reference ARO-P12432
Note For research use only.
Molecular Constructor
Val18–Asn205
Product name ARO-P12432-1MG
Uniprot ID Q8IW35
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNN
Molecular weight 23.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val18-Asn205
Aliases /Synonyms Cep97, Leucine-rich repeat and IQ domain-containing protein 2, LRRIQ2, CEP97, Centrosomal protein of 97 kDa
Reference ARO-P12432
Note For research use only.
Molecular Constructor
Val18–Asn205
Product name ARO-P12432-50
Uniprot ID Q8IW35
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNN
Molecular weight 23.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val18-Asn205
Aliases /Synonyms Cep97, Leucine-rich repeat and IQ domain-containing protein 2, LRRIQ2, CEP97, Centrosomal protein of 97 kDa
Reference ARO-P12432
Note For research use only.
Molecular Constructor
Val18–Asn205

Recombinant Human CEP97 Protein: A Versatile Tool for Studying Cellular Structure and Function

Introduction
Recombinant proteins have become an indispensable tool in modern molecular biology and biotechnology. These proteins are produced by genetically engineering a host organism, such as bacteria or yeast, to express a specific gene of interest. Recombinant proteins have numerous applications in research, diagnostics, and therapeutics, and their production has revolutionized the study of cellular structure and function. One such protein that has gained significant attention in recent years is Recombinant Human CEP97 Protein.

Structure of Recombinant Human CEP97 Protein
CEP97, also known as centrosomal protein 97, is a large protein consisting of 1,137 amino acids. It is a component of the centrosome, a cellular organelle involved in cell division, and is essential for maintaining the structural integrity of the centrosome. The recombinant form of CEP97 is produced by expressing the CEP97 gene in a suitable host organism, such as Escherichia coli, and purifying the protein using various chromatography techniques.

Activity of Recombinant Human CEP97 Protein
The primary function of CEP97 is to regulate the assembly and organization of the centrosome. It interacts with other centrosomal proteins and plays a crucial role in the formation of the centrosomal matrix, a network of proteins that provides structural support to the centrosome. In addition, CEP97 is involved in the recruitment of proteins to the centrosome and the regulation of centrosome duplication, a process essential for cell division. Recombinant Human CEP97 Protein has been shown to exhibit similar activity to its native form, making it a valuable tool for studying the function of CEP97 in cellular processes.

Applications of Recombinant Human CEP97 Protein
Recombinant Human CEP97 Protein has a wide range of applications in both basic and applied research. Its role in centrosome organization and duplication makes it an essential tool for studying cell division, a process that is dysregulated in various diseases, including cancer. By studying the function of CEP97, researchers can gain insights into the mechanisms of cell division and potentially develop new therapeutic strategies for diseases associated with abnormal cell division.

In addition, Recombinant Human CEP97 Protein has been used in studies to elucidate the role of the centrosome in ciliogenesis, the process of forming cilia, which are hair-like structures on the surface of cells involved in various physiological processes. CEP97 has also been implicated in the regulation of cell migration, a process essential for tissue development and repair. By using recombinant CEP97, researchers can investigate the role of this protein in these and other cellular processes.

Conclusion
Recombinant Human CEP97 Protein is a powerful tool for studying the structure and function of the centrosome. Its recombinant form has been shown to exhibit similar activity to its native counterpart, making it an ideal tool for investigating the role of CEP97 in various cellular processes. With its wide range of applications, Recombinant Human CEP97 Protein has the potential to advance our understanding of cell biology and contribute to the development of new therapeutics for diseases associated with centrosome dysfunction.

Recombinant Human CEP97 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CEP97 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products