Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody

  • PTX19928-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: €152.00.Current price is: €118.00.

50ug 22% OFF + 118 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody

Product name PTX19928-100
Uniprot ID Q9Y6L6
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-SLCO1B1, Anti-LST-1, Anti-OATP-2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human
Product name PTX19928-1MG
Uniprot ID Q9Y6L6
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-SLCO1B1, Anti-LST-1, Anti-OATP-2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human
Product name PTX19928-50
Uniprot ID Q9Y6L6
Raw Antigen Sequence FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFF
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-SLCO1B1, Anti-LST-1, Anti-OATP-2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human

Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody binds to Recombinant Human SLCO1B1/LST-1/OATP-2, N-His in WB Assay

Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody binds to Recombinant Human SLCO1B1/LST-1/OATP-2, N-His in WB Assay

Recombinant Human SLCO1B1/LST-1/OATP-2, N-His(cat. No.ARO-P12792) can bind Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-SLCO1B1/LST-1/OATP-2 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products