Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DDX21 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NR30
Molecular weight:
44.50 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Ala187–Ile563
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DDX21 Protein, N-His

Product name ARO-P12431-100
Uniprot ID Q9NR30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRI
Molecular weight 44.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala187-Ile563
Aliases /Synonyms DEAD box protein 21, DDX21, Gu-alpha, Nucleolar RNA helicase II, RH II/Gu, Nucleolar RNA helicase Gu, Nucleolar RNA helicase 2
Reference ARO-P12431
Note For research use only.
Molecular Constructor
Ala187–Ile563
Product name ARO-P12431-1MG
Uniprot ID Q9NR30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRI
Molecular weight 44.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala187-Ile563
Aliases /Synonyms DEAD box protein 21, DDX21, Gu-alpha, Nucleolar RNA helicase II, RH II/Gu, Nucleolar RNA helicase Gu, Nucleolar RNA helicase 2
Reference ARO-P12431
Note For research use only.
Molecular Constructor
Ala187–Ile563
Product name ARO-P12431-50
Uniprot ID Q9NR30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRI
Molecular weight 44.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala187-Ile563
Aliases /Synonyms DEAD box protein 21, DDX21, Gu-alpha, Nucleolar RNA helicase II, RH II/Gu, Nucleolar RNA helicase Gu, Nucleolar RNA helicase 2
Reference ARO-P12431
Note For research use only.
Molecular Constructor
Ala187–Ile563

Introduction

Recombinant Human DDX21 Protein, also known as DEAD-box helicase 21, is a highly conserved protein that plays an essential role in RNA metabolism and innate immune response. It belongs to the DEAD-box RNA helicase family and is involved in various cellular processes such as RNA splicing, translation, and RNA transport. In this article, we will discuss the structure, activity, and application of this protein.

Structure of Recombinant Human DDX21 Protein

The Recombinant Human DDX21 Protein is composed of 727 amino acids with a molecular weight of approximately 81 kDa. It consists of two domains, an N-terminal DEAD-box domain and a C-terminal helicase domain. The DEAD-box domain contains the ATP-binding site, while the helicase domain contains the RNA-binding site. The interaction between these two domains allows the protein to unwind RNA molecules.

The crystal structure of Recombinant Human DDX21 Protein has been determined, revealing a complex arrangement of the two domains. The DEAD-box domain is composed of a central core surrounded by a helical domain, while the helicase domain contains six conserved motifs that are essential for ATP binding and RNA unwinding activity.

Activity of Recombinant Human DDX21 Protein

Recombinant Human DDX21 Protein is a multifunctional protein that is involved in various cellular processes. Its main activity is RNA unwinding, which is essential for RNA metabolism. The protein uses the energy from ATP hydrolysis to unwind double-stranded RNA, allowing for the formation of RNA-protein complexes and facilitating the translation and transport of RNA molecules.

In addition to its role in RNA metabolism, Recombinant Human DDX21 Protein also plays a crucial role in the innate immune response. It has been shown to interact with viral RNA and activate the production of interferon, a key player in the body’s defense against viral infections. This activity makes Recombinant Human DDX21 Protein a potential therapeutic target for antiviral drugs.

Application of Recombinant Human DDX21 Protein

The unique structure and activity of Recombinant Human DDX21 Protein make it a valuable tool in various research fields. Its ability to unwind RNA molecules has been utilized in studies involving RNA splicing, translation, and RNA transport. The protein’s role in the innate immune response has also made it a subject of interest in the development of antiviral therapies.

Recombinant Human DDX21 Protein is also used in diagnostic assays to detect the presence of viral infections. Its ability to bind and activate interferon production can be used to identify viral RNA in patient samples, providing a rapid and sensitive method for virus detection.

Furthermore, Recombinant Human DDX21 Protein has potential applications in the biotechnology industry. Its ability to unwind RNA molecules can be harnessed for the production of recombinant proteins, as it can facilitate the translation of mRNA into protein. This protein has also been shown to play a role in the regulation of gene expression, making it a potential target for gene therapy.

Conclusion

In summary, Recombinant Human DDX21 Protein is a highly conserved protein with a crucial role in RNA metabolism and innate immune response. Its unique structure and activity make it a valuable tool for research and potential applications in various fields. Further studies on this protein may lead to a better understanding of its functions and potential therapeutic uses.

Recombinant Human DDX21 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DDX21 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products