Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PPP1R15B Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5SWA1
Molecular weight:
34.64 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Gly660–Cys713
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PPP1R15B Protein, N-GST & C-His

Product name ARO-P12440-100
Uniprot ID Q5SWA1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQGTCFKGLNVLKQC
Molecular weight 34.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly660-Cys713
Aliases /Synonyms PPP1R15B, Protein phosphatase 1 regulatory subunit 15B
Reference ARO-P12440
Note For research use only.
Molecular Constructor
Gly660–Cys713
Product name ARO-P12440-1MG
Uniprot ID Q5SWA1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQGTCFKGLNVLKQC
Molecular weight 34.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly660-Cys713
Aliases /Synonyms PPP1R15B, Protein phosphatase 1 regulatory subunit 15B
Reference ARO-P12440
Note For research use only.
Molecular Constructor
Gly660–Cys713
Product name ARO-P12440-50
Uniprot ID Q5SWA1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQGTCFKGLNVLKQC
Molecular weight 34.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly660-Cys713
Aliases /Synonyms PPP1R15B, Protein phosphatase 1 regulatory subunit 15B
Reference ARO-P12440
Note For research use only.
Molecular Constructor
Gly660–Cys713

Introduction to Recombinant Human PPP1R15B Protein

Recombinant Human PPP1R15B Protein, also known as Protein Phosphatase 1 Regulatory Subunit 15B, is a crucial component in the regulation of cellular stress response and protein synthesis. This protein is encoded by the PPP1R15B gene and is involved in various biological processes such as cell cycle progression, cell death, and protein folding. In this article, we will explore the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human PPP1R15B Protein

The recombinant form of PPP1R15B protein is produced through genetic engineering techniques, where the gene is inserted into a suitable expression vector and then expressed in a host organism. The resulting protein is a 45 kDa polypeptide consisting of 411 amino acids. It contains a conserved C-terminal domain that is essential for its function in regulating protein phosphatase 1 activity.

The crystal structure of PPP1R15B protein has been determined, revealing a compact structure with a central β-sheet surrounded by α-helices. This structure is similar to other regulatory subunits of protein phosphatase 1, indicating a conserved mechanism of action among these proteins.

Activity of Recombinant Human PPP1R15B Protein

PPP1R15B protein is a key regulator of the Integrated Stress Response (ISR) pathway, which is activated in response to various cellular stresses such as nutrient deprivation, viral infection, and endoplasmic reticulum (ER) stress. This protein binds to and activates the catalytic subunit of protein phosphatase 1, leading to dephosphorylation of eukaryotic initiation factor 2 alpha (eIF2α) and subsequent inhibition of protein synthesis.

In addition to its role in the ISR pathway, PPP1R15B protein has been shown to play a role in cell cycle regulation. It interacts with cyclin-dependent kinase 2 (CDK2) and inhibits its activity, thereby controlling cell cycle progression. This protein also regulates cell death by modulating the activity of the pro-apoptotic protein Bcl-2-associated X protein (BAX).

Applications of Recombinant Human PPP1R15B Protein

The recombinant form of PPP1R15B protein has various applications in the fields of research and medicine. It can be used as an antigen in immunological studies to generate specific antibodies against this protein. These antibodies can then be used to study the expression and localization of PPP1R15B in different cell types and tissues.

Furthermore, recombinant PPP1R15B protein can be used to study the regulation of the ISR pathway and its role in various cellular processes. This protein can also be used in drug discovery and development, as it is a potential target for therapeutic intervention in diseases associated with dysregulated protein synthesis and cell death pathways.

In the field of cancer research, PPP1R15B protein has been identified as a tumor suppressor in various types of cancers, including breast, lung, and colon cancer. Recombinant PPP1R15B protein can be used to study its role in cancer development and progression, and potentially as a therapeutic agent for cancer treatment.

In conclusion, Recombinant Human PPP1R15B Protein is a crucial component in the regulation of cellular stress response and protein synthesis. Its structure and activity have been extensively studied, and it has various applications in research and medicine. Further research on this protein may lead to a better understanding of its role in cellular processes and its potential as a therapeutic target in various diseases.

Recombinant Human PPP1R15B Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human PPP1R15B Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products