Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PTTG1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95997
Molecular weight:
20.19 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Asn121–Asp190
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PTTG1 Protein, N-His-SUMO

Product name ARO-P11297-100
Uniprot ID O95997
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLD
Molecular weight 20.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn121-Asp190
Aliases /Synonyms PTTG1, Esp1-associated protein, EAP1, Securin, TUTR1, PTTG, hPTTG, Pituitary tumor-transforming gene 1 protein, Tumor-transforming protein 1
Reference ARO-P11297
Note For research use only.
Molecular Constructor
Asn121–Asp190
Product name ARO-P11297-1MG
Uniprot ID O95997
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLD
Molecular weight 20.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn121-Asp190
Aliases /Synonyms PTTG1, Esp1-associated protein, EAP1, Securin, TUTR1, PTTG, hPTTG, Pituitary tumor-transforming gene 1 protein, Tumor-transforming protein 1
Reference ARO-P11297
Note For research use only.
Molecular Constructor
Asn121–Asp190
Product name ARO-P11297-50
Uniprot ID O95997
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLD
Molecular weight 20.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn121-Asp190
Aliases /Synonyms PTTG1, Esp1-associated protein, EAP1, Securin, TUTR1, PTTG, hPTTG, Pituitary tumor-transforming gene 1 protein, Tumor-transforming protein 1
Reference ARO-P11297
Note For research use only.
Molecular Constructor
Asn121–Asp190

Introduction

Recombinant Human PTTG1 Protein, also known as Pituitary Tumor-Transforming Gene 1 Protein, is a highly conserved protein that plays a crucial role in cell cycle regulation and tumorigenesis. This protein is encoded by the PTTG1 gene and is expressed in various tissues, including the pituitary gland, placenta, and testis. In this article, we will discuss the structure, activity, and applications of Recombinant Human PTTG1 Protein.

Structure of Recombinant Human PTTG1 Protein

Recombinant Human PTTG1 Protein is a 22 kDa protein consisting of 202 amino acids. It has a conserved N-terminal domain that contains a PTTG1 signature motif and a C-terminal domain that is rich in acidic amino acids. The protein also contains a nuclear localization signal and a PEST sequence, which is involved in protein degradation.

The crystal structure of Recombinant Human PTTG1 Protein has been determined, revealing a compact globular protein with a central β-sheet surrounded by α-helices. The structure suggests that PTTG1 may function as a scaffold protein, interacting with multiple partners to regulate cell cycle progression.

Activity of Recombinant Human PTTG1 Protein

Recombinant Human PTTG1 Protein is a multifunctional protein involved in various cellular processes, including cell proliferation, apoptosis, and DNA repair. It acts as a transcriptional coactivator, binding to transcription factors and enhancing their activity. PTTG1 also interacts with several proteins involved in the cell cycle, such as cyclins and cyclin-dependent kinases, to regulate cell division.

One of the key functions of PTTG1 is its role in promoting cell proliferation. It has been shown to stimulate the expression of growth factors and promote the transition of cells from the G1 to S phase of the cell cycle. In addition, PTTG1 has been implicated in the development and progression of various cancers, including pituitary tumors, breast cancer, and colorectal cancer.

Application of Recombinant Human PTTG1 Protein

Recombinant Human PTTG1 Protein has various applications in both research and clinical settings. It is commonly used as an antigen in studies investigating the role of PTTG1 in cell cycle regulation and cancer development. The protein can also be used as a tool to study protein-protein interactions and identify potential therapeutic targets.

In addition, Recombinant Human PTTG1 Protein has potential clinical applications. It has been proposed as a biomarker for various cancers, as its overexpression has been observed in different tumor types. PTTG1 may also serve as a potential therapeutic target, as studies have shown that targeting PTTG1 can inhibit tumor growth and induce cell death.

Furthermore, Recombinant Human PTTG1 Protein has been used in the development of diagnostic tests for pituitary tumors. As PTTG1 is highly expressed in pituitary adenomas, measuring its levels in blood or tissue samples can aid in the diagnosis and monitoring of these tumors.

Conclusion

Recombinant Human PTTG1 Protein is a multifunctional protein involved in cell cycle regulation and tumorigenesis. Its structure suggests that it may function as a scaffold protein, interacting with multiple partners to regulate various cellular processes. The protein has various applications in research and clinical settings, including as an antigen, biomarker, and potential therapeutic target. Further studies on the structure and function of PTTG1 may provide valuable insights into its role in cancer development and potential therapeutic strategies.

Recombinant Human PTTG1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human PTTG1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products