Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MRPS18B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y676
Molecular weight:
15.95 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Lys52–His166
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MRPS18B Protein, N-His

Product name ARO-P12601-100
Uniprot ID Q9Y676
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYH
Molecular weight 15.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys52-His166
Aliases /Synonyms C6orf14, MRP-S18-2, Mitochondrial small ribosomal subunit protein bS18b, Mitochondrial small ribosomal subunit protein mS40, MRPS18B, MRP-S18-b, 28S ribosomal protein S18b, mitochondrial, S18mt-b, 28S ribosomal protein S18-2, mitochondrial, Mrps18-b
Reference ARO-P12601
Note For research use only.
Molecular Constructor
Lys52–His166
Product name ARO-P12601-1MG
Uniprot ID Q9Y676
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYH
Molecular weight 15.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys52-His166
Aliases /Synonyms C6orf14, MRP-S18-2, Mitochondrial small ribosomal subunit protein bS18b, Mitochondrial small ribosomal subunit protein mS40, MRPS18B, MRP-S18-b, 28S ribosomal protein S18b, mitochondrial, S18mt-b, 28S ribosomal protein S18-2, mitochondrial, Mrps18-b
Reference ARO-P12601
Note For research use only.
Molecular Constructor
Lys52–His166
Product name ARO-P12601-50
Uniprot ID Q9Y676
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYH
Molecular weight 15.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys52-His166
Aliases /Synonyms C6orf14, MRP-S18-2, Mitochondrial small ribosomal subunit protein bS18b, Mitochondrial small ribosomal subunit protein mS40, MRPS18B, MRP-S18-b, 28S ribosomal protein S18b, mitochondrial, S18mt-b, 28S ribosomal protein S18-2, mitochondrial, Mrps18-b
Reference ARO-P12601
Note For research use only.
Molecular Constructor
Lys52–His166

Introduction

Recombinant Human MRPS18B Protein, also known as Mitochondrial Ribosomal Protein S18B, is a protein that plays a crucial role in the formation of the mitochondrial ribosome. This protein is encoded by the MRPS18B gene in humans and is involved in the translation of mitochondrial DNA into functional proteins. In this article, we will discuss the structure, activity, and applications of Recombinant Human MRPS18B Protein.

Structure of Recombinant Human MRPS18B Protein

Recombinant Human MRPS18B Protein is a 16 kDa protein that is composed of 147 amino acids. It is a component of the small subunit of the mitochondrial ribosome and is highly conserved among different species. The protein has a conserved S18 domain, which is essential for its ribosomal function. The crystal structure of MRPS18B has been determined, revealing its unique three-dimensional structure.

Activity of Recombinant Human MRPS18B Protein

The main function of Recombinant Human MRPS18B Protein is to participate in the assembly of the mitochondrial ribosome. This ribosome is responsible for translating the genetic information from mitochondrial DNA into functional proteins. MRPS18B is a part of the small subunit of the ribosome and plays a crucial role in the initiation of protein synthesis. It interacts with other ribosomal proteins and ribosomal RNA to form a functional ribosome.

Apart from its role in protein synthesis, MRPS18B has also been found to have other activities. It has been shown to interact with the tumor suppressor protein p53, which is involved in regulating cell growth and division. MRPS18B has also been implicated in the regulation of apoptosis, or programmed cell death, through its interaction with the pro-apoptotic protein Bax.

Applications of Recombinant Human MRPS18B Protein

Recombinant Human MRPS18B Protein has various applications in both research and medical fields. One of its primary uses is in the study of mitochondrial function and dysfunction. Mutations in the MRPS18B gene have been linked to mitochondrial disorders, and the recombinant protein can be used to investigate these disorders and their underlying mechanisms.

Furthermore, MRPS18B has been identified as a potential target for cancer therapy. Its interaction with p53 and Bax suggests that it may play a role in the regulation of cell growth and survival. Studies have shown that inhibiting MRPS18B can lead to the death of cancer cells, making it a promising target for cancer treatment.

In addition, Recombinant Human MRPS18B Protein has been used in vaccine development. It has been shown to be a potential antigen, meaning it can trigger an immune response in the body. This makes it a suitable candidate for the development of vaccines against diseases caused by mitochondrial dysfunction.

Conclusion

In summary, Recombinant Human MRPS18B Protein is a 16 kDa protein that plays a crucial role in the formation of the mitochondrial ribosome. It is highly conserved among different species and has a unique three-dimensional structure. Its main function is in protein synthesis, but it also has other activities, including its involvement in cancer and apoptosis. Recombinant Human MRPS18B Protein has various applications in research and medicine, making it a valuable tool in understanding mitochondrial function and developing treatments for related disorders.

Recombinant Human MRPS18B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MRPS18B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products