Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CUL4B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13620
Molecular weight:
27.83 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Gly728–Ala913
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CUL4B Protein, N-His

Product name ARO-P12610-100
Uniprot ID Q13620
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA
Molecular weight 27.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly728-Ala913
Aliases /Synonyms Cullin-4B, CUL-4B, CUL4B, KIAA0695
Reference ARO-P12610
Note For research use only.
Molecular Constructor
Gly728–Ala913
Product name ARO-P12610-1MG
Uniprot ID Q13620
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA
Molecular weight 27.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly728-Ala913
Aliases /Synonyms Cullin-4B, CUL-4B, CUL4B, KIAA0695
Reference ARO-P12610
Note For research use only.
Molecular Constructor
Gly728–Ala913
Product name ARO-P12610-50
Uniprot ID Q13620
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA
Molecular weight 27.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly728-Ala913
Aliases /Synonyms Cullin-4B, CUL-4B, CUL4B, KIAA0695
Reference ARO-P12610
Note For research use only.
Molecular Constructor
Gly728–Ala913

Introduction to Recombinant Human CUL4B Protein

Recombinant Human CUL4B Protein is a type of protein that is produced through genetic engineering techniques. This protein is a member of the Cullin family of proteins, which play a crucial role in the regulation of protein degradation and cell cycle progression. The CUL4B protein is encoded by the CUL4B gene and is involved in various cellular processes, including DNA replication, repair, and transcription. In this article, we will provide a scientific description of the structure, activity, and application of Recombinant Human CUL4B Protein.

Structure of Recombinant Human CUL4B Protein

The Recombinant Human CUL4B Protein is a 90 kDa protein that consists of 759 amino acids. It is composed of several domains, including a N-terminal domain, a C-terminal domain, and a central domain. The N-terminal domain contains a conserved BTB (Bric-a-brac, Tramtrack, and Broad-complex) domain, which is responsible for protein-protein interactions. The C-terminal domain contains a conserved Cullin homology domain, which is essential for the formation of the Cullin-RING E3 ubiquitin ligase complex. The central domain contains a WD40 repeat domain, which is involved in substrate recognition and binding.

Activity of Recombinant Human CUL4B Protein

Recombinant Human CUL4B Protein plays a crucial role in the regulation of protein degradation through the ubiquitin-proteasome pathway. It forms a complex with other proteins, including DDB1 (DNA damage-binding protein 1), RBX1 (RING-box protein 1), and DCAF (DDB1 and CUL4-associated factor) proteins, to form the Cullin-RING E3 ubiquitin ligase complex. This complex is involved in the transfer of ubiquitin molecules to target proteins, leading to their degradation by the proteasome.

In addition to its role in protein degradation, Recombinant Human CUL4B Protein is also involved in various cellular processes, including DNA replication, repair, and transcription. It has been shown to interact with several proteins involved in these processes, suggesting its role in their regulation.

Application of Recombinant Human CUL4B Protein

Recombinant Human CUL4B Protein has various applications in both research and therapeutic settings. Its role in protein degradation makes it a valuable tool for studying the regulation of protein turnover in cells. It can also be used to study the role of the ubiquitin-proteasome pathway in various diseases, including cancer.

In therapeutic settings, Recombinant Human CUL4B Protein has potential as a target for drug development. Its involvement in various cellular processes makes it a promising target for the treatment of diseases such as cancer and neurodegenerative disorders.

Moreover, Recombinant Human CUL4B Protein can also be used as an antigen in the development of diagnostic tests for certain diseases. Antibodies against this protein can be used to detect its expression levels in cells, which can provide valuable information about the status of various cellular processes.

Conclusion

Recombinant Human CUL4B Protein is a crucial protein involved in the regulation of protein degradation and various cellular processes. Its structure, activity, and application have been extensively studied, and it has shown potential as a target for drug development and diagnostic purposes. Further research on this protein can provide a better understanding of its role in cellular processes and its potential as a therapeutic target.

Recombinant Human CUL4B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CUL4B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products