Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ROCK1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13464
Molecular weight:
42.90 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Met1–Thr351
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ROCK1 Protein, N-His

Product name ARO-P12603-100
Uniprot ID Q13464
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDT
Molecular weight 42.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr351
Aliases /Synonyms Renal carcinoma antigen NY-REN-35, p160 ROCK-1, p160ROCK, Rho-associated protein kinase 1, Rho-associated, coiled-coil-containing protein kinase I, Rho-associated, coiled-coil-containing protein kinase 1, ROCK-I, ROCK1
Reference ARO-P12603
Note For research use only.
Molecular Constructor
Met1–Thr351
Product name ARO-P12603-1MG
Uniprot ID Q13464
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDT
Molecular weight 42.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr351
Aliases /Synonyms Renal carcinoma antigen NY-REN-35, p160 ROCK-1, p160ROCK, Rho-associated protein kinase 1, Rho-associated, coiled-coil-containing protein kinase I, Rho-associated, coiled-coil-containing protein kinase 1, ROCK-I, ROCK1
Reference ARO-P12603
Note For research use only.
Molecular Constructor
Met1–Thr351
Product name ARO-P12603-50
Uniprot ID Q13464
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDT
Molecular weight 42.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr351
Aliases /Synonyms Renal carcinoma antigen NY-REN-35, p160 ROCK-1, p160ROCK, Rho-associated protein kinase 1, Rho-associated, coiled-coil-containing protein kinase I, Rho-associated, coiled-coil-containing protein kinase 1, ROCK-I, ROCK1
Reference ARO-P12603
Note For research use only.
Molecular Constructor
Met1–Thr351

Title: Introduction to Recombinant Human ROCK1 Protein

Recombinant human ROCK1 protein is a crucial enzyme that plays a significant role in the regulation of cell shape, movement, and proliferation. This protein is encoded by the ROCK1 gene and belongs to the Rho-associated coiled-coil containing protein kinase (ROCK) family. It is widely expressed in various tissues and is involved in multiple cellular processes, making it a valuable tool for scientific research and potential therapeutic applications.

Structure of Recombinant Human ROCK1 Protein

The recombinant human ROCK1 protein is a 160 kDa protein composed of 1352 amino acids. It contains a kinase domain at the N-terminus, followed by a coiled-coil region and a PH domain. The C-terminus of the protein contains a cysteine-rich domain and a pleckstrin homology (PH) domain. The kinase domain is responsible for the catalytic activity of ROCK1, while the coiled-coil region and PH domain are involved in protein-protein interactions and membrane binding, respectively.

Activity of Recombinant Human ROCK1 Protein

ROCK1 is a serine/threonine kinase that regulates various cellular processes, including cell shape, adhesion, migration, and contraction. It is activated by the small GTPase RhoA, which binds to the Rho-binding domain of ROCK1, leading to its translocation to the plasma membrane. Once activated, ROCK1 phosphorylates downstream targets, such as myosin light chain (MLC) and myosin phosphatase target subunit 1 (MYPT1), which regulate actin cytoskeleton dynamics and cell contractility.

In addition to its role in cytoskeleton regulation, ROCK1 also plays a crucial role in cell proliferation and survival. It has been shown to promote cell cycle progression by phosphorylating and activating the transcription factor YAP, which regulates the expression of genes involved in cell proliferation. Furthermore, ROCK1 has been implicated in the regulation of cell survival and apoptosis by modulating the activity of Bcl-2 family proteins.

Application of Recombinant Human ROCK1 Protein

The recombinant human ROCK1 protein has been extensively used in scientific research to elucidate its role in various cellular processes. It has been studied in the context of cancer, cardiovascular diseases, and neurological disorders. In cancer, ROCK1 has been shown to promote tumor growth, invasion, and metastasis by regulating cell migration and proliferation. Therefore, targeting ROCK1 has emerged as a potential therapeutic strategy for cancer treatment.

In cardiovascular diseases, ROCK1 has been implicated in the pathogenesis of hypertension, atherosclerosis, and heart failure. Its activity has been linked to the regulation of vascular smooth muscle cell contraction, endothelial cell function, and cardiac myocyte hypertrophy. Thus, recombinant human ROCK1 protein has been used to study the mechanisms underlying these diseases and to identify potential therapeutic targets.

In the field of neuroscience, ROCK1 has been linked to the pathogenesis of neurodegenerative disorders, such as Alzheimer’s disease and Parkinson’s disease. It has been shown to regulate neuronal morphology, synaptic plasticity, and axonal growth. Therefore, recombinant human ROCK1 protein has been used to investigate the role of ROCK1 in these disorders and to identify potential therapeutic interventions.

Conclusion

In summary, recombinant human ROCK1 protein is a crucial enzyme involved in the regulation of various cellular processes. Its structure, activity, and function have been extensively studied, and it has been implicated in the pathogenesis of various diseases. The availability of recombinant human ROCK1 protein has greatly advanced our understanding of its role in cellular processes and its potential as a therapeutic target. Further research on this protein will continue to provide valuable insights into its function and potential applications in medicine.

Recombinant Human ROCK1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ROCK1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products