Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human ILF3, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q12906
Molecular weight:
24.49 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Tyr672–Tyr891
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human ILF3, N-His

Recombinant Human ILF3, N-His

Product name ARO-P12864-100
Uniprot ID Q12906
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNY
Molecular weight 24.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr672-Tyr891
Aliases /Synonyms ILF3, MPHOSPH4, DRBP76, TCP80, DRBF, Translational control protein 80, M-phase phosphoprotein 4, Nuclear factor associated with dsRNA, NF90, NFAR, MPP4, NF-AT-90, Double-stranded RNA-binding protein 76, Interleukin enhancer-binding factor 3, Nuclear factor of activated T-cells 90 kDa
Reference ARO-P12864
Note For research use only.
Molecular Constructor
Tyr672–Tyr891
Product name ARO-P12864-1MG
Uniprot ID Q12906
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNY
Molecular weight 24.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr672-Tyr891
Aliases /Synonyms ILF3, MPHOSPH4, DRBP76, TCP80, DRBF, Translational control protein 80, M-phase phosphoprotein 4, Nuclear factor associated with dsRNA, NF90, NFAR, MPP4, NF-AT-90, Double-stranded RNA-binding protein 76, Interleukin enhancer-binding factor 3, Nuclear factor of activated T-cells 90 kDa
Reference ARO-P12864
Note For research use only.
Molecular Constructor
Tyr672–Tyr891
Product name ARO-P12864-50
Uniprot ID Q12906
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNY
Molecular weight 24.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr672-Tyr891
Aliases /Synonyms ILF3, MPHOSPH4, DRBP76, TCP80, DRBF, Translational control protein 80, M-phase phosphoprotein 4, Nuclear factor associated with dsRNA, NF90, NFAR, MPP4, NF-AT-90, Double-stranded RNA-binding protein 76, Interleukin enhancer-binding factor 3, Nuclear factor of activated T-cells 90 kDa
Reference ARO-P12864
Note For research use only.
Molecular Constructor
Tyr672–Tyr891

Recombinant Human ILF3, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ILF3, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products