Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NCL Protein, N-His & N-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P19338
Molecular weight:
22.11 kDa

Original price was: €341.00.Current price is: €275.00.

100ug 19% OFF + 275 loyalty points
Lys486–Arg561
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NCL Protein, N-His & N-SUMO

Product name ARO-P12774-100
Uniprot ID P19338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPR
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys486-Arg561
Aliases /Synonyms Protein C23, NCL, Nucleolin
Reference ARO-P12774
Note For research use only.
Molecular Constructor
Lys486–Arg561
Product name ARO-P12774-1MG
Uniprot ID P19338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPR
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys486-Arg561
Aliases /Synonyms Protein C23, NCL, Nucleolin
Reference ARO-P12774
Note For research use only.
Molecular Constructor
Lys486–Arg561
Product name ARO-P12774-50
Uniprot ID P19338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPR
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys486-Arg561
Aliases /Synonyms Protein C23, NCL, Nucleolin
Reference ARO-P12774
Note For research use only.
Molecular Constructor
Lys486–Arg561

Introduction

Recombinant proteins have become essential tools in various fields of research, diagnostics, and therapeutics. These proteins are produced through genetic engineering techniques, where specific genes are inserted into host cells to produce large quantities of the desired protein. One such recombinant protein is the Human NCL Protein, which has gained significant attention due to its diverse functions and potential applications. In this article, we will discuss the structure, activity, and application of Recombinant Human NCL Protein.

Structure of Recombinant Human NCL Protein

The Human NCL Protein, also known as Nucleolin, is a multifunctional protein that is found in the nucleolus, a subcompartment of the cell nucleus. It is encoded by the NCL gene, which is located on chromosome 2 in humans. The protein is composed of 707 amino acids and has a molecular weight of approximately 76 kDa. It is a highly conserved protein, with similar sequences found in various species, including mammals, birds, and plants.

The primary structure of Human NCL Protein consists of three major domains: an N-terminal domain, a central RNA-binding domain, and a C-terminal acidic domain. The N-terminal domain is responsible for the protein’s localization to the nucleolus, while the central domain contains four RNA-binding sites, allowing the protein to interact with various types of RNA. The C-terminal domain is rich in acidic amino acids and is involved in protein-protein interactions.

The three-dimensional structure of Human NCL Protein has been determined through X-ray crystallography and NMR spectroscopy. It forms a compact structure, with the RNA-binding domain forming a globular structure and the N- and C-terminal domains extending outwards. This structure allows the protein to interact with multiple molecules, making it a vital player in various cellular processes.

Activity of Recombinant Human NCL Protein

The Human NCL Protein is involved in various cellular activities, including ribosome biogenesis, DNA replication and repair, and regulation of gene expression. It is primarily known for its role in ribosome biogenesis, where it binds to ribosomal RNA and helps in the assembly of ribosomes, the cellular machinery responsible for protein synthesis. It also plays a crucial role in DNA replication and repair by interacting with proteins involved in these processes.

Moreover, Human NCL Protein has been shown to regulate the expression of genes involved in cell proliferation and apoptosis. It can bind to specific DNA sequences and modulate the transcription of these genes. It has also been found to play a role in viral infection, where it interacts with viral proteins and regulates their activity.

Application of Recombinant Human NCL Protein

Due to its diverse functions, Recombinant Human NCL Protein has potential applications in various fields. In research, it is used as a tool to study ribosome biogenesis, gene expression, and DNA repair mechanisms. It has also been studied as a potential target for cancer therapy, as it is overexpressed in many types of cancer cells. In addition, it has been explored as a biomarker for certain types of cancer, making it a promising diagnostic tool.

Recombinant Human NCL Protein has also been investigated for its potential as a therapeutic agent. It has been shown to have anti-inflammatory and anti-viral properties, making it a potential candidate for the treatment of inflammatory and viral diseases. It has also been studied as a potential drug target for neurodegenerative diseases, as it has been found to be involved in the pathogenesis of these diseases.

Conclusion

In summary, Recombinant Human NCL Protein is a multifunctional protein with a complex structure and diverse activities. It plays a crucial role in various cellular processes and has potential applications in research, diagnostics, and

Recombinant Human NCL Protein, N-His & N-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human NCL Protein, N-His & N-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products