Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SRSF2/SC-35 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q01130
Molecular weight:
13.85 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Met1–Ser101
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SRSF2/SC-35 Protein, N-His

Product name ARO-P12662-100
Uniprot ID Q01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Molecular weight 13.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser101
Aliases /Synonyms Splicing factor SC35, Splicing factor, arginine/serine-rich 2, SC-35, Serine/arginine-rich splicing factor 2, SFRS2, SRSF2, Splicing component, 35 kDa, Protein PR264
Reference ARO-P12662
Note For research use only.
Molecular Constructor
Met1–Ser101
Product name ARO-P12662-1MG
Uniprot ID Q01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Molecular weight 13.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser101
Aliases /Synonyms Splicing factor SC35, Splicing factor, arginine/serine-rich 2, SC-35, Serine/arginine-rich splicing factor 2, SFRS2, SRSF2, Splicing component, 35 kDa, Protein PR264
Reference ARO-P12662
Note For research use only.
Molecular Constructor
Met1–Ser101
Product name ARO-P12662-50
Uniprot ID Q01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Molecular weight 13.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser101
Aliases /Synonyms Splicing factor SC35, Splicing factor, arginine/serine-rich 2, SC-35, Serine/arginine-rich splicing factor 2, SFRS2, SRSF2, Splicing component, 35 kDa, Protein PR264
Reference ARO-P12662
Note For research use only.
Molecular Constructor
Met1–Ser101

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of specific proteins for research and therapeutic purposes. One such recombinant protein is the Recombinant Human SRSF2/SC-35 Protein, which has been extensively studied for its structure, activity, and potential applications.

Structure of Recombinant Human SRSF2/SC-35 Protein

The Recombinant Human SRSF2/SC-35 Protein is a 35 kDa protein that is encoded by the SRSF2 gene. It is a member of the serine/arginine-rich splicing factor (SRSF) family and is also known as the SC-35 protein. This protein is composed of 260 amino acids and contains two RNA recognition motifs (RRMs) and a serine/arginine-rich (RS) domain.

The RRMs are responsible for binding to specific RNA sequences, while the RS domain is involved in protein-protein interactions and plays a crucial role in alternative splicing. The structure of the Recombinant Human SRSF2/SC-35 Protein has been extensively studied using techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy, providing valuable insights into its function and potential applications.

Activity of Recombinant Human SRSF2/SC-35 Protein

The primary function of the Recombinant Human SRSF2/SC-35 Protein is to regulate alternative splicing, a process by which different combinations of exons in a pre-mRNA are selected to produce multiple mRNA isoforms from a single gene. This protein binds to specific RNA sequences and recruits other splicing factors to form a spliceosome, which is responsible for the removal of introns and the joining of exons.

Furthermore, the Recombinant Human SRSF2/SC-35 Protein has been shown to play a role in other cellular processes such as mRNA export, translation, and RNA stability. It has also been implicated in various diseases, including cancer and neurodegenerative disorders, highlighting its importance in cellular function and disease pathology.

Application of Recombinant Human SRSF2/SC-35 Protein

The Recombinant Human SRSF2/SC-35 Protein has a wide range of potential applications, particularly in the field of biotechnology and medicine. One of its main applications is in the study of alternative splicing, as it is a key player in this process and its recombinant form allows for easier manipulation and analysis in research settings.

Additionally, the Recombinant Human SRSF2/SC-35 Protein has been investigated as a potential therapeutic target for diseases that involve aberrant splicing, such as cancer. Manipulation of this protein could potentially lead to the development of novel treatments for these diseases.

Moreover, the Recombinant Human SRSF2/SC-35 Protein has also been used in diagnostic tests for diseases such as acute myeloid leukemia, where its expression pattern can serve as a biomarker for disease progression and prognosis.

Conclusion

The Recombinant Human SRSF2/SC-35 Protein is a crucial protein involved in alternative splicing and other cellular processes. Its structure and activity have been extensively studied, providing valuable insights into its function and potential applications. With its wide range of potential uses in research and medicine, this recombinant protein holds great promise for further advancements in the understanding and treatment of various diseases.

Recombinant Human SRSF2/SC-35 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SRSF2/SC-35 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products