Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ERAL1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75616
Molecular weight:
20.54 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Arg94–Glu256
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ERAL1 Protein, N-His

Product name ARO-P12375-100
Uniprot ID O75616
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTE
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg94-Glu256
Aliases /Synonyms Conserved ERA-like GTPase, HERA, GTPase Era, mitochondrial, ERA-like protein 1, H-ERA, ERAL1, hERA, ERA-W, CEGA
Reference ARO-P12375
Note For research use only.
Molecular Constructor
Arg94–Glu256
Product name ARO-P12375-1MG
Uniprot ID O75616
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTE
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg94-Glu256
Aliases /Synonyms Conserved ERA-like GTPase, HERA, GTPase Era, mitochondrial, ERA-like protein 1, H-ERA, ERAL1, hERA, ERA-W, CEGA
Reference ARO-P12375
Note For research use only.
Molecular Constructor
Arg94–Glu256
Product name ARO-P12375-50
Uniprot ID O75616
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTE
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg94-Glu256
Aliases /Synonyms Conserved ERA-like GTPase, HERA, GTPase Era, mitochondrial, ERA-like protein 1, H-ERA, ERAL1, hERA, ERA-W, CEGA
Reference ARO-P12375
Note For research use only.
Molecular Constructor
Arg94–Glu256

Introduction

Recombinant Human ERAL1 Protein, also known as GTPase Era-like protein 1, is a highly conserved protein that plays a crucial role in various cellular processes. It belongs to the GTPase superfamily, which is involved in the regulation of cellular signaling and metabolism. In this article, we will discuss the structure, activity, and applications of Recombinant Human ERAL1 Protein.

Structure of Recombinant Human ERAL1 Protein

The human ERAL1 gene is located on chromosome 17 and consists of 8 exons. The protein is composed of 327 amino acids and has a molecular weight of approximately 38 kDa. It contains a conserved GTP-binding domain and a GTPase-activating domain, which are essential for its function.

The crystal structure of Recombinant Human ERAL1 Protein has been determined, revealing an overall fold similar to other GTPases. It consists of a central beta-sheet surrounded by alpha-helices and loops. The GTP-binding domain contains a glycine-rich loop, which is responsible for binding to GTP. The GTPase-activating domain is located at the C-terminus and is involved in the hydrolysis of GTP.

Activity of Recombinant Human ERAL1 Protein

Recombinant Human ERAL1 Protein is a GTPase, which means it has the ability to bind and hydrolyze GTP. GTP hydrolysis is essential for the regulation of various cellular processes, including protein synthesis, signal transduction, and cell proliferation. Recombinant Human ERAL1 Protein has been shown to interact with several proteins involved in these processes, suggesting its role in their regulation.

One of the key functions of Recombinant Human ERAL1 Protein is its involvement in ribosome biogenesis. It has been shown to interact with ribosomal proteins and is required for the assembly of the large ribosomal subunit. It is also involved in the maturation of the 18S rRNA, which is essential for ribosome function.

In addition to its role in ribosome biogenesis, Recombinant Human ERAL1 Protein has been implicated in mitochondrial function. It has been shown to interact with mitochondrial ribosomal proteins and is required for the assembly of the mitochondrial ribosome. It is also involved in the regulation of mitochondrial translation, which is essential for the proper functioning of mitochondria.

Applications of Recombinant Human ERAL1 Protein

Recombinant Human ERAL1 Protein has a wide range of applications in both basic research and clinical settings. Its involvement in ribosome biogenesis and mitochondrial function makes it a valuable tool for studying these processes. It can be used to investigate the role of ERAL1 in protein synthesis and the regulation of mitochondrial translation.

In addition, Recombinant Human ERAL1 Protein has potential therapeutic applications. It has been shown to be overexpressed in certain types of cancer, including lung cancer and breast cancer. Targeting ERAL1 could potentially inhibit tumor growth and provide a new treatment option for these cancers.

Furthermore, Recombinant Human ERAL1 Protein has been identified as a potential biomarker for certain diseases. It has been shown to be elevated in patients with Alzheimer’s disease and may serve as a diagnostic marker for this condition.

Conclusion

In summary, Recombinant Human ERAL1 Protein is a highly conserved GTPase involved in ribosome biogenesis and mitochondrial function. Its crystal structure has been determined, revealing a similar fold to other GTPases. It has a wide range of applications in basic research and potential therapeutic and diagnostic uses. Further studies on the structure and function of Recombinant Human ERAL1 Protein may provide new insights into its role in cellular processes and its potential as a therapeutic target.

Recombinant Human ERAL1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ERAL1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products