Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ESRP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6NXG1
Molecular weight:
23.55 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Met1–Ser193
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ESRP1 Protein, N-His

Product name ARO-P11198-100
Uniprot ID Q6NXG1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMIS
Molecular weight 23.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser193
Aliases /Synonyms RNA-binding protein 35A, Epithelial splicing regulatory protein 1, ESRP1, RNA-binding motif protein 35A, RBM35A
Reference ARO-P11198
Note For research use only.
Molecular Constructor
Met1–Ser193
Product name ARO-P11198-1MG
Uniprot ID Q6NXG1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMIS
Molecular weight 23.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser193
Aliases /Synonyms RNA-binding protein 35A, Epithelial splicing regulatory protein 1, ESRP1, RNA-binding motif protein 35A, RBM35A
Reference ARO-P11198
Note For research use only.
Molecular Constructor
Met1–Ser193
Product name ARO-P11198-50
Uniprot ID Q6NXG1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMIS
Molecular weight 23.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser193
Aliases /Synonyms RNA-binding protein 35A, Epithelial splicing regulatory protein 1, ESRP1, RNA-binding motif protein 35A, RBM35A
Reference ARO-P11198
Note For research use only.
Molecular Constructor
Met1–Ser193

Introduction to Recombinant Human ESRP1 Protein

Recombinant Human ESRP1 Protein, also known as Epithelial Splicing Regulatory Protein 1, is a type of recombinant protein that plays a crucial role in regulating alternative splicing of pre-mRNA transcripts. This protein is encoded by the ESRP1 gene and is essential for the proper functioning of the human body.

Structure of Recombinant Human ESRP1 Protein

Recombinant Human ESRP1 Protein is a 54 kDa protein consisting of 475 amino acids. It belongs to the RNA-binding motif (RRM) family and contains two RNA recognition motifs (RRMs) at its N-terminus. These RRMs are responsible for the binding of ESRP1 to specific RNA sequences, thereby regulating alternative splicing.

The C-terminus of Recombinant Human ESRP1 Protein contains a proline-rich region, which is involved in protein-protein interactions. This region interacts with other splicing factors and regulates the activity of ESRP1 in alternative splicing.

Activity of Recombinant Human ESRP1 Protein

The main activity of Recombinant Human ESRP1 Protein is the regulation of alternative splicing. Alternative splicing is a process in which different exons from a single gene are combined in different ways to produce multiple protein isoforms. This process is crucial for the diversity of proteins in the human body and plays a significant role in various physiological processes.

ESRP1 protein acts as a splicing factor and binds to specific RNA sequences in pre-mRNA transcripts, thereby influencing the splicing process. It promotes the inclusion of specific exons and the exclusion of others, resulting in the production of different protein isoforms. This activity of ESRP1 is essential for the proper functioning of various tissues, including the epithelial cells of the skin, lungs, and intestines.

Application of Recombinant Human ESRP1 Protein

The application of Recombinant Human ESRP1 Protein is primarily focused on its role in regulating alternative splicing. This protein has been found to be dysregulated in various diseases, including cancer, neurodegenerative disorders, and autoimmune diseases. Therefore, it has potential therapeutic applications in these conditions.

In cancer, ESRP1 has been shown to regulate the splicing of genes involved in cell proliferation, invasion, and metastasis. Its dysregulation has been linked to the development and progression of various types of cancer, including breast, lung, and colon cancer. Recombinant Human ESRP1 Protein can be used to study the role of this protein in cancer and develop targeted therapies to modulate its activity.

In neurodegenerative disorders, ESRP1 has been found to regulate the splicing of genes involved in neuronal function and survival. Its dysregulation has been linked to conditions such as Alzheimer’s disease and Parkinson’s disease. Recombinant Human ESRP1 Protein can be used to study the role of this protein in neurodegenerative disorders and develop potential therapeutic interventions.

Moreover, ESRP1 has also been found to play a role in autoimmune diseases, such as multiple sclerosis and inflammatory bowel disease. Its dysregulation has been linked to the abnormal production of cytokines and inflammatory mediators. Recombinant Human ESRP1 Protein can be used to study the role of this protein in autoimmune diseases and develop targeted therapies to modulate its activity.

Conclusion

In conclusion, Recombinant Human ESRP1 Protein is a crucial protein involved in the regulation of alternative splicing. Its structure, activity, and application have been extensively studied and have shown its potential as a therapeutic target in various diseases. Further research on this protein may lead to the development of novel treatments for cancer, neurodegenerative disorders, and autoimmune diseases.

Recombinant Human ESRP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ESRP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products