Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ADCY5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95622
Molecular weight:
24.10 kDa

Original price was: €382.00.Current price is: €329.00.

100ug 14% OFF + 329 loyalty points
Ser1066–Ser1261
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ADCY5 Protein, N-His

Product name ARO-P11181-100
Uniprot ID O95622
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1066-Ser1261
Aliases /Synonyms AC5, ATP pyrophosphate-lyase 5, Adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ADCY5
Reference ARO-P11181
Note For research use only.
Molecular Constructor
Ser1066–Ser1261
Product name ARO-P11181-1MG
Uniprot ID O95622
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1066-Ser1261
Aliases /Synonyms AC5, ATP pyrophosphate-lyase 5, Adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ADCY5
Reference ARO-P11181
Note For research use only.
Molecular Constructor
Ser1066–Ser1261
Product name ARO-P11181-50
Uniprot ID O95622
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1066-Ser1261
Aliases /Synonyms AC5, ATP pyrophosphate-lyase 5, Adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ADCY5
Reference ARO-P11181
Note For research use only.
Molecular Constructor
Ser1066–Ser1261

Introduction

Recombinant human ADCY5 protein is a highly sought-after protein in the scientific community due to its role in various cellular processes. This protein is encoded by the ADCY5 gene and is a member of the adenylyl cyclase family. It is known to play a crucial role in the production of the second messenger molecule, cyclic adenosine monophosphate (cAMP), which is involved in numerous signaling pathways.

Structure of Recombinant Human ADCY5 Protein

The recombinant human ADCY5 protein is a 137 kDa protein composed of 1152 amino acids. It has a conserved structure, with two transmembrane domains and two cytoplasmic catalytic domains. The N-terminal transmembrane domain is responsible for anchoring the protein to the cell membrane, while the C-terminal catalytic domain contains the active site for cAMP production. The protein also contains several regulatory domains, including a G protein regulatory domain and a calmodulin-binding domain.

Activity of Recombinant Human ADCY5 Protein

The primary function of recombinant human ADCY5 protein is to catalyze the conversion of ATP to cAMP. This activity is regulated by various factors, including G protein-coupled receptors, calcium ions, and hormones. Upon activation, the protein undergoes a conformational change that allows it to bind to ATP and catalyze the production of cAMP. The cAMP produced by ADCY5 then acts as a secondary messenger, activating downstream signaling pathways and regulating various cellular processes, including metabolism, cell growth, and gene expression.

Applications of Recombinant Human ADCY5 Protein

1. Drug Development

Recombinant human ADCY5 protein has been identified as a potential drug target for various diseases, including diabetes, obesity, and cancer. As cAMP is involved in regulating glucose and lipid metabolism, targeting ADCY5 could potentially lead to the development of new treatments for metabolic disorders. Additionally, the protein’s role in cell growth and proliferation makes it a promising target for anti-cancer drugs.

2. Research Tool

The availability of recombinant human ADCY5 protein has greatly facilitated research on cAMP signaling and its role in various cellular processes. Scientists can use this protein to study the regulation of ADCY5 activity and its interaction with other molecules. It can also be used to screen for potential drugs that can modulate ADCY5 activity.

3. Immunogen

Recombinant human ADCY5 protein can be used as an antigen to generate antibodies against the protein. These antibodies can then be used in various applications, such as western blotting, immunohistochemistry, and flow cytometry, to study the expression and localization of ADCY5 in different tissues and cell types.

4. Biomarker

Recent studies have shown that ADCY5 expression levels are altered in various diseases, including type 2 diabetes, Parkinson’s disease, and bipolar disorder. As such, recombinant human ADCY5 protein can potentially serve as a biomarker for these diseases, aiding in their diagnosis and monitoring.

Conclusion

In summary, recombinant human ADCY5 protein is a crucial player in cAMP signaling and has various applications in drug development, research, and diagnostics. Its conserved structure and activity make it an ideal target for studying cellular processes and developing new treatments for diseases. With the continued advancements in recombinant protein technology, we can expect to see further insights into the role of ADCY5 in health and disease.

Recombinant Human ADCY5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ADCY5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products