Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ravagalimab Biosimilar – Anti-CD40, TNFRSF mAb – Research Grade

  • PX-TA1510-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €192.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ravagalimab Biosimilar - Anti-CD40, TNFRSF mAb - Research Grade

Product name Ravagalimab Biosimilar - Anti-CD40, TNFRSF mAb - Research Grade
Uniprot ID P25942
Source CAS 2050816-56-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ravagalimab,ABBV-323,CD40, TNFRSF,anti-CD40, TNFRSF
Reference PX-TA1510
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Ravagalimab Biosimilar - Anti-CD40, TNFRSF mAb - Research Grade
Uniprot ID P25942
Source CAS 2050816-56-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ravagalimab,ABBV-323,CD40, TNFRSF,anti-CD40, TNFRSF
Reference PX-TA1510
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1510-50
Uniprot ID P25942
Source CAS 2050816-56-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ravagalimab,ABBV-323,CD40, TNFRSF,anti-CD40, TNFRSF
Reference PX-TA1510
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Ravagalimab Biosimilar – Anti-CD40, TNFRSF mAb

Ravagalimab Biosimilar, also known as Anti-CD40, TNFRSF mAb, is a monoclonal antibody that targets the CD40 protein, a member of the tumor necrosis factor receptor superfamily (TNFRSF). This biosimilar is a research grade version of the original drug, which has shown promising results in clinical trials for the treatment of various diseases. In this article, we will explore the structure, activity, and potential applications of Ravagalimab Biosimilar.

Structure of Ravagalimab Biosimilar

Ravagalimab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced in a laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) that recognize and bind to the CD40 protein, and one crystallizable fragment (Fc) that mediates effector functions.

Mechanism of Action

The main target of Ravagalimab Biosimilar is the CD40 protein, which is expressed on the surface of various immune cells, including B cells, dendritic cells, and macrophages. Upon binding to CD40, the antibody triggers a cascade of signaling events that lead to the activation of these immune cells. This activation results in the production of pro-inflammatory cytokines and the enhancement of immune responses, making it a potent therapeutic agent for various diseases.

Title: Therapeutic Applications

Ravagalimab Biosimilar has shown great potential in the treatment of autoimmune diseases, such as rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis. It has also been investigated as a potential therapy for various cancers, including non-Hodgkin lymphoma, chronic lymphocytic leukemia, and melanoma. Additionally, the antibody has shown promising results in the prevention of transplant rejection and the treatment of graft-versus-host disease.

Advantages of Ravagalimab Biosimilar

Compared to the original drug, Ravagalimab Biosimilar offers several advantages. Firstly, as a biosimilar, it has a similar structure and activity to the original drug, making it a reliable alternative. Secondly, its production in a laboratory setting allows for better quality control and a more consistent supply. Finally, since it is a research grade version, it can be used for pre-clinical studies and research purposes, providing valuable insights into its potential therapeutic applications.

Title: Clinical Trials and

Safety Profile

Ravagalimab Biosimilar has undergone several clinical trials, with promising results. In a phase II trial for rheumatoid arthritis, the antibody showed significant improvement in disease activity and was well-tolerated by patients. In another phase II trial for systemic lupus erythematosus, Ravagalimab Biosimilar demonstrated a favorable safety profile and showed potential for reducing disease activity. Additionally, in a phase I trial for multiple sclerosis, the antibody was well-tolerated and showed promising results in reducing disease activity.

Conclusion

In conclusion, Ravagalimab Biosimilar – Anti-CD40, TNFRSF mAb – Research Grade, is a promising therapeutic agent for various diseases. Its structure, mechanism of action, and potential applications make it a valuable tool for researchers and a potential treatment option for patients. With ongoing clinical trials and further research, this biosimilar has the potential to improve the lives of many individuals suffering from autoimmune diseases and cancers.

SDS-PAGE for Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Ravagalimab Biosimilar - Anti-CD40, TNFRSF mAb - Research Grade

There are no reviews yet.

Be the first to review “Ravagalimab Biosimilar – Anti-CD40, TNFRSF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products