Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ranibizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Ranibizumab ELISA Kit

Ranibizumab ELISA Kit

Product name Ranibizumab ELISA Kit
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX189
Note For research use only.
Sample type Plasma, Serum
Target Ranibizumab
Immunogen Ranibizumab

Ranibizumab ELISA Kit: A Revolutionary Tool for Detecting and Quantifying Anti-Ranibizumab Antibodies

Introduction

Ranibizumab is a recombinant humanized monoclonal antibody that targets vascular endothelial growth factor (VEGF) and is used for the treatment of various ocular disorders, including age-related macular degeneration (AMD), diabetic macular edema, and retinal vein occlusion. However, in some patients, the development of anti-ranibizumab antibodies can limit the efficacy of this therapeutic agent. Therefore, the accurate detection and quantification of these antibodies is crucial for monitoring the response to treatment and optimizing patient outcomes. The Ranibizumab ELISA Kit is a powerful tool that enables researchers and clinicians to measure the levels of anti-ranibizumab antibodies in various biological samples.

Structure of Ranibizumab

Ranibizumab is a 48 kDa recombinant humanized monoclonal antibody that is composed of two identical heavy chains and two identical light chains. The heavy chains consist of 453 amino acids, while the light chains consist of 214 amino acids. Ranibizumab is derived from the humanized murine monoclonal antibody fragment Fab, and its structure is highly specific for binding to VEGF. The Fab fragment of ranibizumab binds to VEGF with high affinity, preventing its interaction with its receptors and inhibiting neovascularization and vascular permeability in ocular tissues.

Activity of Ranibizumab

The main therapeutic activity of ranibizumab is its ability to bind to VEGF and inhibit its biological activity. VEGF is a key mediator of angiogenesis, and its overexpression is implicated in the pathogenesis of various ocular disorders. By binding to VEGF, ranibizumab prevents the activation of VEGF receptors and inhibits the downstream signaling pathways that promote neovascularization and vascular leakage. This results in the regression of abnormal blood vessels and the reduction of fluid accumulation in the retina, leading to improved visual acuity and decreased risk of disease progression.

Application of Ranibizumab ELISA Kit

The Ranibizumab ELISA Kit is a highly sensitive and specific tool for detecting and quantifying anti-ranibizumab antibodies in various biological samples, including serum, plasma, and aqueous humor. This kit utilizes a sandwich enzyme-linked immunosorbent assay (ELISA) technique, in which ranibizumab is coated onto the surface of a microplate and serves as the capture antibody. The sample is then added to the plate, and any anti-ranibizumab antibodies present in the sample will bind to the coated ranibizumab. After washing away any unbound material, a secondary antibody conjugated to an enzyme is added, which will bind to the captured anti-ranibizumab antibodies. The addition of a substrate results in a color change, which is measured and compared to a standard curve to determine the concentration of anti-ranibizumab antibodies in the sample.

The Ranibizumab ELISA Kit has several important applications in the field of ophthalmology. It can be used to monitor the development of anti-ranibizumab antibodies in patients receiving ranibizumab therapy, which can help guide treatment decisions and prevent the loss of efficacy. It can also be used to assess the immunogenicity of ranibizumab in clinical trials, providing valuable information about the safety and efficacy of this therapeutic agent. Additionally, the Ranibizumab ELISA Kit can be used to investigate the potential impact of anti-ranibizumab antibodies on the pharmacokinetics and pharmacodynamics of ranibizumab, which can further enhance our understanding of this important therapeutic target.

Conclusion

In conclusion, the Ranibizumab ELISA Kit is a powerful tool for detecting and quantifying anti-ranibizumab antibodies in various biological samples. Its high sensitivity and specificity make it an invaluable resource for monitoring the response to ran

Ranibizumab ELISA Kit

There are no reviews yet.

Be the first to review “Ranibizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products