Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Proto-oncogene c-Fos(FOS)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P01100
Molecular weight:
41.7kDa

Original price was: €207.00.Current price is: €182.00.

50ug 12% OFF + 182 loyalty points
Met1–Leu380 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Proto-oncogene c-Fos(FOS)

Product name Proto-oncogene c-Fos(FOS)
Uniprot ID P01100
Uniprot link https://www.uniprot.org/uniprot/P01100
Expression system Prokaryotic expression
Raw Antigen Sequence MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Molecular weight 41.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS PH7.5, 0.02 %Sarcosyl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu380
Protein Accession P01100
Spec:Entrez GeneID 2353
Spec:NCBI Gene Aliases p55; AP-1; C-FOS
Spec:SwissProtID B4DQ65
NCBI Reference P01100
Aliases /Synonyms Cellular oncogene fos,G0/G1 switch regulatory protein 7,G0S7
Reference PX-P4762
Note For research use only
Molecular Constructor
Met1–Leu380 His
Product name Proto-oncogene c-Fos(FOS)
Uniprot ID P01100
Uniprot link https://www.uniprot.org/uniprot/P01100
Expression system Prokaryotic expression
Raw Antigen Sequence MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Molecular weight 41.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS PH7.5, 0.02 %Sarcosyl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu380
Protein Accession P01100
Spec:Entrez GeneID 2353
Spec:NCBI Gene Aliases p55; AP-1; C-FOS
Spec:SwissProtID B4DQ65
NCBI Reference P01100
Aliases /Synonyms Cellular oncogene fos,G0/G1 switch regulatory protein 7,G0S7
Reference PX-P4762
Note For research use only
Molecular Constructor
Met1–Leu380 His
Product name PX-P4762-1MG
Uniprot ID P01100
Uniprot link https://www.uniprot.org/uniprot/P01100
Expression system Prokaryotic expression
Raw Antigen Sequence MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Molecular weight 41.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS PH7.5, 0.02 %Sarcosyl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu380
Protein Accession P01100
Spec:Entrez GeneID 2353
Spec:NCBI Gene Aliases p55; AP-1; C-FOS
Spec:SwissProtID B4DQ65
NCBI Reference P01100
Aliases /Synonyms Cellular oncogene fos,G0/G1 switch regulatory protein 7,G0S7
Reference PX-P4762
Note For research use only
Molecular Constructor
Met1–Leu380 His

Proto-oncogene c-Fos(FOS)

There are no reviews yet.

Be the first to review “Proto-oncogene c-Fos(FOS)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products