Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q04637
Molecular weight:
23.49kDa

Original price was: €231.00.Current price is: €210.00.

50ug 9% OFF + 210 loyalty points
Glu557~Lys646
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)

Product name Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)
Uniprot ID Q04637
Uniprot link http://www.uniprot.org/uniprot/Q04637
Expression system Prokaryotic expression
Raw Antigen Sequence ESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight 23.49kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM HEPES, pH 7.2, 100 mM KCl containing 2 mM dithiothreitol and 0.5 mM EDTA.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu557~Lys646
Aliases /Synonyms EIF4F, EIF4G, EIF4GI,eIF-4-gamma 1,eIF-4G 1,eIF-4G1,p220
Reference PX-P4550
Note For research use only
Molecular Constructor
Glu557~Lys646
Product name Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)
Uniprot ID Q04637
Uniprot link http://www.uniprot.org/uniprot/Q04637
Expression system Prokaryotic expression
Raw Antigen Sequence ESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight 23.49kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM HEPES, pH 7.2, 100 mM KCl containing 2 mM dithiothreitol and 0.5 mM EDTA.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu557~Lys646
Aliases /Synonyms EIF4F, EIF4G, EIF4GI,eIF-4-gamma 1,eIF-4G 1,eIF-4G1,p220
Reference PX-P4550
Note For research use only
Molecular Constructor
Glu557~Lys646
Product name PX-P4550-1MG
Uniprot ID Q04637
Uniprot link http://www.uniprot.org/uniprot/Q04637
Expression system Prokaryotic expression
Raw Antigen Sequence ESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight 23.49kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM HEPES, pH 7.2, 100 mM KCl containing 2 mM dithiothreitol and 0.5 mM EDTA.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu557~Lys646
Aliases /Synonyms EIF4F, EIF4G, EIF4GI,eIF-4-gamma 1,eIF-4G 1,eIF-4G1,p220
Reference PX-P4550
Note For research use only
Molecular Constructor
Glu557~Lys646

Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)

There are no reviews yet.

Be the first to review “Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products