Tomato Le_eIFiso4E Recombinant Protein

Reference:
Product nameTomato Le_eIFiso4E Recombinant Protein
Uniprot IDA7Y4C8
Uniprot linkhttp://www.uniprot.org/uniprot/A7Y4C8
Origin speciesTomato
Expression systemProcaryotic expression
SequenceMSGHHHHHHAMATEAPVEATEIPSVAAAETVEKQPHKLERKWTFWFDNQSKPKQGVAWGSSLRKAYTFETVEEFWSLYDQ IFKPSKVTVNADFHLFKAGIEPKWEDPECANGGKWTATSSRKANLETMWLETLMALVGEQFDESEDICGVVASVRRSQDK LSLWTKTATNEAAQMGIGRKWKEIIDAEKISYSFHDDSKRERSAKSRYTV
Molecular weight23,95 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferPBS, Urea 8M, imidazole 10mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionNP_001234772.1
Spec:Entrez GeneID100134893
Spec:SwissProtIDA7Y4C8
NCBI ReferenceNP_001234772.1
Aliases /SynonymsLe_eIFiso4E, eukaryotic translation initiation factor iso4E
ReferencePX-P1120
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Tomato Le_eIFiso4E Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.