Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

PelB-DN1-ST (virer PelB) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P16455
Molecular weight:
37.88 kDa

Original price was: €235.00.Current price is: €210.00.

50ug 11% OFF + 210 loyalty points
Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

PelB-DN1-ST (virer PelB) Recombinant Protein

Product name PelB-DN1-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSFAMAWFRQAPGKEREFVAAISWSGSTGHADSVKGRFTITRDNAKNTVFLQMNSLKPEDTAVYYCALGKGSSYYYSPSGYDYWGQGTQVTVSSGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 37.88 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN1-ST (virer PelB), O-6-methylguanine-DNA methyltransferase, SNAP-XDocII fusion protein
Reference PX-P2086
Note For research use only
Molecular Constructor
Yes
Product name PelB-DN1-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSFAMAWFRQAPGKEREFVAAISWSGSTGHADSVKGRFTITRDNAKNTVFLQMNSLKPEDTAVYYCALGKGSSYYYSPSGYDYWGQGTQVTVSSGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 37.88 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN1-ST (virer PelB), O-6-methylguanine-DNA methyltransferase, SNAP-XDocII fusion protein
Reference PX-P2086
Note For research use only
Molecular Constructor
Yes
Product name PX-P2086-1MG
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSFAMAWFRQAPGKEREFVAAISWSGSTGHADSVKGRFTITRDNAKNTVFLQMNSLKPEDTAVYYCALGKGSSYYYSPSGYDYWGQGTQVTVSSGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 37.88 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN1-ST (virer PelB), O-6-methylguanine-DNA methyltransferase, SNAP-XDocII fusion protein
Reference PX-P2086
Note For research use only
Molecular Constructor
Yes

PelB-DN1-ST (virer PelB) Recombinant Protein

  • Waller BH, Olson DG, Currie DH, Guss AM, Lynd LR. Exchange of type II dockerin-containing subunits of the Clostridium thermocellum cellulosome as revealed by SNAP-tags. FEMS Microbiol Lett. 2013 Jan;338(1):46-53. doi: 10.1111/1574-6968.12029. Epub 2012 Nov 30. PubMed PMID: 23082914.

There are no reviews yet.

Be the first to review “PelB-DN1-ST (virer PelB) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products