Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Phosphatidylinositol 4-kinase alpha 1(PI4KA1) (1-344)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9SXA1
Molecular weight:
38.83kDa

€329.00

100ug + 329 loyalty points
Met1–Gln344
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Phosphatidylinositol 4-kinase alpha 1(PI4KA1) (1-344)

Phosphatidylinositol 4-kinase alpha 1(PI4KA1) (1-344)

Product name Phosphatidylinositol 4-kinase alpha 1(PI4KA1) (1-344)
Uniprot ID Q9SXA1
Uniprot link http://www.uniprot.org/uniprot/Q9SXA1
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMEALTELCDIIAKNPKQFSEKLAWICGRCPQTEWLLAESPRVSRSHLNAVLAVARIISKNPESIDNRAK SVVNEFLSAIPASFRRSFWPHSFPSQLISSFYCDFLSYLSCAADLSPEFGTEVARFTGEVVIAAIAPSSGDSDGDPAISK AFLVALSQHFPSILQSDGDKLITMLLDQFVLNRAPASPKEQRQQNSANSETDTSSSQGSPISTNRYPSGKTEMASPGDEV ASHGSNLSSKSSSSVVMNGGSIVWKSGVDQLSFGFSEGSGGANPVFRQQVASFEDESIESLEKQEIAFRLITHILDKVKI DSKLQDQVRFIAKRQLQSMSAFLKSRKRDWNEQGQ
Molecular weight 38.83kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS pH 7.5, 4 M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln344
Aliases /Synonyms Phosphatidylinositol 4-kinase alpha 1, PI4-kinase alpha 1, PtdIns-4-kinase alpha 1, Phosphatidylinositol 4-OH kinase alpha1, AtPI4Kalpha1, PI-4Kalpha1
Reference PX-P4509
Note For research use only
Molecular Constructor
Met1–Gln344
Product name Phosphatidylinositol 4-kinase alpha 1(PI4KA1) (1-344)
Uniprot ID Q9SXA1
Uniprot link http://www.uniprot.org/uniprot/Q9SXA1
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMEALTELCDIIAKNPKQFSEKLAWICGRCPQTEWLLAESPRVSRSHLNAVLAVARIISKNPESIDNRAK SVVNEFLSAIPASFRRSFWPHSFPSQLISSFYCDFLSYLSCAADLSPEFGTEVARFTGEVVIAAIAPSSGDSDGDPAISK AFLVALSQHFPSILQSDGDKLITMLLDQFVLNRAPASPKEQRQQNSANSETDTSSSQGSPISTNRYPSGKTEMASPGDEV ASHGSNLSSKSSSSVVMNGGSIVWKSGVDQLSFGFSEGSGGANPVFRQQVASFEDESIESLEKQEIAFRLITHILDKVKI DSKLQDQVRFIAKRQLQSMSAFLKSRKRDWNEQGQ
Molecular weight 38.83kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS pH 7.5, 4 M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln344
Aliases /Synonyms Phosphatidylinositol 4-kinase alpha 1, PI4-kinase alpha 1, PtdIns-4-kinase alpha 1, Phosphatidylinositol 4-OH kinase alpha1, AtPI4Kalpha1, PI-4Kalpha1
Reference PX-P4509
Note For research use only
Molecular Constructor
Met1–Gln344

There are no reviews yet.

Be the first to review “Phosphatidylinositol 4-kinase alpha 1(PI4KA1) (1-344)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products